Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.46
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.400 0.013
Breast cancer 2.100 0.028
ovarian cancer 2.300 0.000

Synonym

Accession Q5J8M3 A8K3A9 B4DJQ4 Q96KX9 Q9BUI5 Q9P0T9
Symbols PIG17
TMEM85

Gene

 GO Process (1)

Gene RIF (1)

PMID Text
18586032 TMEM85 is a complex gene that encodes a novel conserved anti-apoptotic protein.

AA Sequence

MTAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCW      1 - 70
DIALGPLKQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMAISATFKMLESSSQKFLQGLVYLIGN     71 - 140
LMGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEFSGGGLLL                               141 - 183
//

Text Mined References (18)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22119785 2011 Defining human ERAD networks through an integrative mapping strategy.
21269460 2011 Initial characterization of the human central proteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18586032 2008 Transmembrane protein 85 from both human (TMEM85) and yeast (YGL231c) inhibit hydrogen peroxide mediated cell death in yeast.
More...