Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.33
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Gene RIF (1)

PMID Text
15772680 This gene is thought to encode a peptide that displays antimicrobial activity.

AA Sequence

MKLLLLLLTVTLLLAQVTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVKPKLTDTNTSL      1 - 70
ESTSAV                                                                     71 - 76
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15772680 2005 Identification, characterization, and evolution of a primate beta-defensin gene cluster.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.