Property Summary

NCBI Gene PubMed Count 7
PubMed Score 19.14
PubTator Score 1.53

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Protein-protein Interaction (3)

Gene RIF (1)

AA Sequence

MAQLEGYCFSAALSCTFLVSCLLFSAFSRALREPYMDEIFHLPQAQRYCEGHFSLSQWDPMITTLPGLYL      1 - 70
VSVGVVKPAIWIFAWSEHVVCSIGMLRFVNLLFSVGNFYLLYLLFHKVQPRNKAASSIQRVLSTLTLAVF     71 - 140
PTLYFFNFLYYTEAGSMFFTLFAYLMCLYGNHKTSAFLGFCGFMFRQTNIIWAVFCAGNVIAQKLTEAWK    141 - 210
TELQKKEDRLPPIKGPFAEFRKILQFLLAYSMSFKNLSMLFCLTWPYILLGFLFCAFVVVNGGIVIGDRS    211 - 280
SHEACLHFPQLFYFFSFTLFFSFPHLLSPSKIKTFLSLVWKHGILFLVVTLVSVFLVWKFTYAHKYLLAD    281 - 350
NRHYTFYVWKRVFQRYAILKYLLVPAYIFAGWSIADSLKSKPIFWNLMFFICLFIVIVPQKLLEFRYFIL    351 - 420
PYVIYRLNITLPPTSRLVCELSCYAIVNFITFYIFLNKTFQWPNSQDIQRFMW                     421 - 473
//

Text Mined References (9)

PMID Year Title