Property Summary

NCBI Gene PubMed Count 7
PubMed Score 16.19
PubTator Score 1.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession Q5I7T1 B2RPF4
Symbols KCR1
ALG10

Gene

Gene RIF (1)

PMID Text
20950623 Findings suggest that KCR1 genetic variations that diminish the ability of KCR1 to protect KCNH2 from inhibition by commonly used therapeutic agents constitute a risk factor for the aLQTS.

AA Sequence

MAQLEGYCFSAALSCTFLVSCLLFSAFSRALREPYMDEIFHLPQAQRYCEGHFSLSQWDPMITTLPGLYL      1 - 70
VSVGVVKPAIWIFAWSEHVVCSIGMLRFVNLLFSVGNFYLLYLLFHKVQPRNKAASSIQRVLSTLTLAVF     71 - 140
PTLYFFNFLYYTEAGSMFFTLFAYLMCLYGNHKTSAFLGFCGFMFRQTNIIWAVFCAGNVIAQKLTEAWK    141 - 210
TELQKKEDRLPPIKGPFAEFRKILQFLLAYSMSFKNLSMLFCLTWPYILLGFLFCAFVVVNGGIVIGDRS    211 - 280
SHEACLHFPQLFYFFSFTLFFSFPHLLSPSKIKTFLSLVWKHGILFLVVTLVSVFLVWKFTYAHKYLLAD    281 - 350
NRHYTFYVWKRVFQRYAILKYLLVPAYIFAGWSIADSLKSKPIFWNLMFFICLFIVIVPQKLLEFRYFIL    351 - 420
PYVIYRLNITLPPTSRLVCELSCYAIVNFITFYIFLNKTFQWPNSQDIQRFMW                     421 - 473
//

Text Mined References (9)

PMID Year Title
20950623 2011 A KCR1 variant implicated in susceptibility to the long QT syndrome.
19483685 2009 HLA-B*5701 genotype is a major determinant of drug-induced liver injury due to flucloxacillin.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15280551 2004 In vivo identification of genes that modify ether-a-go-go-related gene activity in Caenorhabditis elegans may also affect human cardiac arrhythmia.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14525949 2003 The IKr drug response is modulated by KCR1 in transfected cardiac and noncardiac cell lines.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.