Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.09
PubTator Score 0.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 6.78686095390627E-10
Pick disease 1893 0.00412539494468908
progressive supranuclear palsy 674 0.0150979833444778
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0196706146775811
group 3 medulloblastoma 2254 0.0253142687349416
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0269566833167901

Expression

Synonym

Accession Q5I0X7 TPR repeat protein 32
Symbols

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

AA Sequence

MEGQRQESHATLTLAQAHFNNGEYAEAEALYSAYIRRCACAASSDESPGSKCSPEDLATAYNNRGQIKYF      1 - 70
RVDFYEAMDDYTSAIEVQPNFEVPYYNRGLILYRLGYFDDALEDFKKVLDLNPGFQDATLSLKQTILDKE     71 - 140
EKQRRNVAKNY                                                               141 - 151
//

Text Mined References (5)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22751097 2012 Genome-wide association study in Han Chinese identifies four new susceptibility loci for coronary artery disease.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.