Property Summary

NCBI Gene PubMed Count 5
PubMed Score 8.83
PubTator Score 3.81

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 1.800 1.1e-16

Gene RIF (1)

AA Sequence

MSEASGNLNSLRMANVALREELNALRGENANLGLQLGRALAEVNSLRGNVSSYIRWPVPIVPVLAEENLE      1 - 70
FALSEIEVIPGGELPFLCRPPPRAEPDCISDDLLINVIQDRSTPDGPADPPLLPIPPPPALPPPASKEPP     71 - 140
PQPPLAPLERPEIEPFSGDPVYLAEFLMQLETFIADHEVHFPGGAERVAFLISFFTGEAKDWAISVTQEG    141 - 210
SPLHANFPRFLDEIRKEFCGPIPPRVAKKAIRKLKQGHCTLGSYADAFQFLAQFLSWDDCRLQNQFLKGL    211 - 280
SEFFRKELLWSTEMADLDELILECVEIERKVRVPKPIPLPGVRNIIFPFAPSPNEEESEDEEYYSEDEDQ    281 - 350
EARRHRLHSKDQRKRMRAFQQEMKEKEEEEMKKEEEMKKKEEKEEEEEEEMKQKEEEEEIRNKNEEEGES    351 - 420
KDEEDEDEDGGQKPEGEPQQDPGTEETYGEVEEEPLDEAQDDDLDELMEMEPTFVHASSQTSGPTSGYHA    421 - 490
ENFLGASPPIIQPSRRRNQNRVPLLEGLPGTNSPFYSSPQLIRRTGRLGQRQVRRRPPVLFRLTPRQGGH    491 - 560
RAARGRIRV                                                                 561 - 569
//

Text Mined References (7)

PMID Year Title