Property Summary

NCBI Gene PubMed Count 5
Grant Count 2
Funding $332,824.66
PubMed Score 8.41
PubTator Score 3.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 1.800 0.000

Synonym

Accession Q5HYW3 A7E2W7 Q8NCM4 Q9NPX1
Symbols MAR5
MART5
6430402L03Rik

Gene

 Grant Application (2)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
18976975 Knockdown of retrotransposon gag domain containing 4 (RGAG4) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MSEASGNLNSLRMANVALREELNALRGENANLGLQLGRALAEVNSLRGNVSSYIRWPVPIVPVLAEENLE      1 - 70
FALSEIEVIPGGELPFLCRPPPRAEPDCISDDLLINVIQDRSTPDGPADPPLLPIPPPPALPPPASKEPP     71 - 140
PQPPLAPLERPEIEPFSGDPVYLAEFLMQLETFIADHEVHFPGGAERVAFLISFFTGEAKDWAISVTQEG    141 - 210
SPLHANFPRFLDEIRKEFCGPIPPRVAKKAIRKLKQGHCTLGSYADAFQFLAQFLSWDDCRLQNQFLKGL    211 - 280
SEFFRKELLWSTEMADLDELILECVEIERKVRVPKPIPLPGVRNIIFPFAPSPNEEESEDEEYYSEDEDQ    281 - 350
EARRHRLHSKDQRKRMRAFQQEMKEKEEEEMKKEEEMKKKEEKEEEEEEEMKQKEEEEEIRNKNEEEGES    351 - 420
KDEEDEDEDGGQKPEGEPQQDPGTEETYGEVEEEPLDEAQDDDLDELMEMEPTFVHASSQTSGPTSGYHA    421 - 490
ENFLGASPPIIQPSRRRNQNRVPLLEGLPGTNSPFYSSPQLIRRTGRLGQRQVRRRPPVLFRLTPRQGGH    491 - 560
RAARGRIRV                                                                 561 - 569
//

Text Mined References (7)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16093683 2005 A family of neofunctionalized Ty3/gypsy retrotransposon genes in mammalian genomes.
15772651 2005 The DNA sequence of the human X chromosome.
15716091 2005 Transposable elements as a source of genetic innovation: expression and evolution of a family of retrotransposon-derived neogenes in mammals.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12056414 2002 Characterization of size-fractionated cDNA libraries generated by the in vitro recombination-assisted method.