Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.53
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.200 1.7e-02
astrocytic glioma -1.300 1.3e-02
atypical teratoid / rhabdoid tumor -1.400 2.8e-04
ependymoma -1.800 2.2e-03
glioblastoma -1.100 3.5e-02
non-small cell lung cancer -1.042 1.7e-10
oligodendroglioma -1.500 2.5e-03
osteosarcoma -1.818 5.7e-03
ovarian cancer -1.100 6.7e-08
pituitary cancer 1.400 2.9e-05

Synonym

Accession Q5HYW2 B2RN94
Symbols

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

AA Sequence

MESMGMVYSVPSSCNGPTESTFSTSWKGDAFTYMTPSATSQSNQVNENGKNPSCGNSWVSLNKVPPLVPK      1 - 70
EAATLLVARDNPAGCSGSAGYPERLIQQRHMPERPSKIGLLTSGTSRLETGPGGASRFRERSLSVPTDSG     71 - 140
TTDVDYDEEQKANEACALPFASTSSEGSNSADNIASLSAQQEAQHRRQRSKSISLRKAKKKPSPPTRSVS    141 - 210
LVKDEPGLLPEGGSALPKDQRPKSLCLSLEHQGHHSSHPDAQGHPAIPNHKDPESTQFSHHWYLTDWKSG    211 - 280
DTYQSLSSSSTATGTTVIECTQVQGSSESLASPSTSRATTPSQLSIEVEAREISSPGRPPGLMSPSSGYS    281 - 350
SQSETPTPTVSMSLTLGHLPPPSSSVRVRPVVPERKSSLPPTSPMEKFPKSRLSFDLPLTSSPNLDLSGM    351 - 420
SISIRSKTKVSRHHSETNFGVKLAQKTNPNQPIMPMVTQSDLRSVRLRSVSKSEPEDDIESPEYAEEPRA    421 - 490
EEVFTLPERKTKPPVAEKPPVARRPPSLVHKPPSVPEEYALTSPTLAMPPRSSIQHARPLPQDSYTVVRK    491 - 560
PKPSSFPDGRSPGESTAPSSLVFTPFASSSDAFFSGTQQPPQGSVEDEGPKVRVLPERISLQSQEEAEKK    561 - 630
KGKIPPPVPKKPSVLYLPLTSPTAQMEAYVAEPRLPLSPIITLEEDTKCPATGDDLQSLGQRVTSTPQAD    631 - 700
SEREASPLG                                                                 701 - 709
//

Text Mined References (5)

PMID Year Title