Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.50
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma multiforme 347 2.50320113678104E-18
non-small cell lung cancer 2798 1.74394963938121E-10
ovarian cancer 8492 6.71845295042585E-8
pituitary cancer 1972 2.89735560846648E-5
atypical teratoid / rhabdoid tumor 4369 2.82247883018998E-4
ependymoma 2514 0.00221407736617953
oligodendroglioma 2849 0.002502220855185
osteosarcoma 7933 0.00573407876665796
astrocytic glioma 2241 0.0132894821521706
adult high grade glioma 2148 0.0168767268678174

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.300 0.013
ependymoma -1.800 0.002
oligodendroglioma -1.500 0.003
glioblastoma multiforme -1.200 0.000
osteosarcoma -1.818 0.006
atypical teratoid / rhabdoid tumor -1.400 0.000
non-small cell lung cancer -1.042 0.000
adult high grade glioma -1.200 0.017
ovarian cancer -1.100 0.000
pituitary cancer 1.400 0.000

Synonym

Accession Q5HYW2 B2RN94
Symbols

Gene

  Ortholog (3)

Species Source
Mouse OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid

 Compartment GO Term (2)

AA Sequence

MESMGMVYSVPSSCNGPTESTFSTSWKGDAFTYMTPSATSQSNQVNENGKNPSCGNSWVSLNKVPPLVPK      1 - 70
EAATLLVARDNPAGCSGSAGYPERLIQQRHMPERPSKIGLLTSGTSRLETGPGGASRFRERSLSVPTDSG     71 - 140
TTDVDYDEEQKANEACALPFASTSSEGSNSADNIASLSAQQEAQHRRQRSKSISLRKAKKKPSPPTRSVS    141 - 210
LVKDEPGLLPEGGSALPKDQRPKSLCLSLEHQGHHSSHPDAQGHPAIPNHKDPESTQFSHHWYLTDWKSG    211 - 280
DTYQSLSSSSTATGTTVIECTQVQGSSESLASPSTSRATTPSQLSIEVEAREISSPGRPPGLMSPSSGYS    281 - 350
SQSETPTPTVSMSLTLGHLPPPSSSVRVRPVVPERKSSLPPTSPMEKFPKSRLSFDLPLTSSPNLDLSGM    351 - 420
SISIRSKTKVSRHHSETNFGVKLAQKTNPNQPIMPMVTQSDLRSVRLRSVSKSEPEDDIESPEYAEEPRA    421 - 490
EEVFTLPERKTKPPVAEKPPVARRPPSLVHKPPSVPEEYALTSPTLAMPPRSSIQHARPLPQDSYTVVRK    491 - 560
PKPSSFPDGRSPGESTAPSSLVFTPFASSSDAFFSGTQQPPQGSVEDEGPKVRVLPERISLQSQEEAEKK    561 - 630
KGKIPPPVPKKPSVLYLPLTSPTAQMEAYVAEPRLPLSPIITLEEDTKCPATGDDLQSLGQRVTSTPQAD    631 - 700
SEREASPLG                                                                 701 - 709
//

Text Mined References (5)

PMID Year Title
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.