Property Summary

NCBI Gene PubMed Count 6
PubMed Score 21.33
PubTator Score 7.15

Knowledge Summary

Patent

No data available

Synonym

Accession Q5HYN5 B9EIR8
Symbols CT45
CT45-1
CT45.1

Gene

 Compartment GO Term (1)

Gene RIF (4)

PMID Text
26098711 These data verify CT45 expression and promoter hypomethylation as possible prognostic biomarkers, and suggest CT45 as an immunological or therapeutic target in Epithelial ovarian cancer
24901056 CT45A1 functions as a novel proto-oncogene to trigger oncogenesis and metastasis.
20133697 Hodgkin lymphoma has the highest CT45 expression among all malignancies tested, in diffuse large B-cell lymphomas it is similar to that seen in epithelial cancers, and not present in low-grade non-Hodgkin B-cell lymphomas.
19296537 Over-expression of CT45 is associated with cancer.

AA Sequence

MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMTGHAIPPSQLD      1 - 70
SQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQK     71 - 140
YEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI                         141 - 189
//

Text Mined References (8)

PMID Year Title
26098711 2015 DNA hypomethylation-mediated activation of Cancer/Testis Antigen 45 (CT45) genes is associated with disease progression and reduced survival in epithelial ovarian cancer.
24901056 2014 CT45A1 acts as a new proto-oncogene to trigger tumorigenesis and cancer metastasis.
20133697 2010 Expression of cancer testis antigen CT45 in classical Hodgkin lymphoma and other B-cell lymphomas.
19296537 2009 Cancer/testis antigen CT45: analysis of mRNA and protein expression in human cancer.
15905330 2005 Identification of cancer/testis-antigen genes by massively parallel signature sequencing.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.