Property Summary

NCBI Gene PubMed Count 6
PubMed Score 21.71
PubTator Score 7.15

Knowledge Summary

Patent

No data available

Gene RIF (4)

AA Sequence

MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMTGHAIPPSQLD      1 - 70
SQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQK     71 - 140
YEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI                         141 - 189
//

Text Mined References (8)

PMID Year Title