Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.47
PubTator Score 0.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.800 3.0e-04
astrocytic glioma -1.100 2.6e-02
glioblastoma -1.600 8.3e-05
group 3 medulloblastoma -2.700 8.4e-05
lung carcinoma 1.100 8.7e-16
medulloblastoma, large-cell -2.300 3.1e-05
osteosarcoma -1.403 2.1e-03
posterior fossa group A ependymoma -1.200 6.0e-04
primitive neuroectodermal tumor -1.600 3.7e-03
subependymal giant cell astrocytoma -1.192 2.7e-02

Gene RIF (1)

AA Sequence

MTATAEVETPKMEKSASKEEKQQPKQDSTEQGNADSEEWMSSESDPEQISLKSSDNSKSCQPRDGQLKKK      1 - 70
EMHSKPHRQLCRSPCLDRPSFSQSSILQDGKLDLEKEYQAKMEFALKLGYAEEQIQSVLNKLGPESLIND     71 - 140
VLAELVRLGNKGDSEGQINLSLLVPRGPSSREIASPELSLEDEIDNSDNLRPVVIDGSNVAMSHGNKEEF    141 - 210
SCRGIQLAVDWFLDKGHKDITVFVPAWRKEQSRPDAPITDQDILRKLEKEKILVFTPSRRVQGRRVVCYD    211 - 280
DRFIVKLAFDSDGIIVSNDNYRDLQVEKPEWKKFIEERLLMYSFVNDKFMPPDDPLGRHGPSLENFLRKR    281 - 350
PIVPEHKKQPCPYGKKCTYGHKCKYYHPERANQPQRSVADELRISAKLSTVKTMSEGTLAKCGTGMSSAK    351 - 420
GEITSEVKRVAPKRQSDPSIRSVAMEPEEWLSIARKPEASSVPSLVTALSVPTIPPPKSHAVGALNTRSA    421 - 490
SSPVPGSSHFPHQKASLEHMASMQYPPILVTNSHGTPISYAEQYPKFESMGDHGYYSMLGDFSKLNINSM    491 - 560
HNREYYMAEVDRGVYARNPNLCSDSRVSHTRNDNYSSYNNVYLAVADTHPEGNLKLHRSASQNRLQPFPH    561 - 630
GYHEALTRVQSYGPEDSKQGPHKQSVPHLALHAQHPSTGTRSSCPADYPMPPNIHPGATPQPGRALVMTR    631 - 700
MDSISDSRLYESNPVRQRRPPLCREQHASWDPLPCTTDSYGYHSYPLSNSLMQPCYEPVMVRSVPEKMEQ    701 - 770
LWRNPWVGMCNDSREHMIPEHQYQTYKNLCNIFPSNIVLAVMEKNPHTADAQQLAALIVAKLRAAR        771 - 836
//

Text Mined References (9)

PMID Year Title