Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.71
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ependymoma 2514 8.12985101072028E-10
atypical teratoid / rhabdoid tumor 4369 2.47838671942215E-7
medulloblastoma 1524 1.06446931043133E-5
glioblastoma 5572 7.40831451207068E-4
astrocytic glioma 2241 0.0119871052413791
adult high grade glioma 2148 0.0190988430605207
medulloblastoma, large-cell 6234 0.0286473878090708

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.700 0.012
ependymoma -2.700 0.000
glioblastoma -3.200 0.001
medulloblastoma -3.100 0.000
atypical teratoid / rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell -2.700 0.029
adult high grade glioma -2.300 0.019

Gene RIF (1)

PMID Text
26056045 TMEM196 acts as a novel functional tumour suppressor inactivated by DNA methylation and is an independent prognostic factor of lung cancer

AA Sequence

MCTSGQIIGSLLVLSVLEIGLGVSSVAVGAVSFSLALREHKPQLGDSSPVWSGVCFLLCGICGILCAKKK      1 - 70
SGLVMILFSACCICGLIGGILNFQFLRAVTKKTSSLYPLHLASMSLACIGIGGCTLSSWLTCRLASYEQR     71 - 140
RMFSEREHSLHHSHEMAEKEITDNMSNGGPQLIFNGRV                                    141 - 178
//

Text Mined References (7)

PMID Year Title
26056045 2015 TMEM196 acts as a novel functional tumour suppressor inactivated by DNA methylation and is a potential prognostic biomarker in lung cancer.
25256182 2014 Genome-wide association study of intracranial aneurysm identifies a new association on chromosome 7.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17903292 2007 A genome-wide association for kidney function and endocrine-related traits in the NHLBI's Framingham Heart Study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.