Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.71
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -2.300 1.9e-02
astrocytic glioma -1.700 1.2e-02
atypical teratoid / rhabdoid tumor -3.600 2.5e-07
ependymoma -1.900 1.3e-02
glioblastoma -1.900 1.5e-03
medulloblastoma -1.900 3.0e-03
medulloblastoma, large-cell -2.700 2.9e-02

Gene RIF (1)

AA Sequence

MCTSGQIIGSLLVLSVLEIGLGVSSVAVGAVSFSLALREHKPQLGDSSPVWSGVCFLLCGICGILCAKKK      1 - 70
SGLVMILFSACCICGLIGGILNFQFLRAVTKKTSSLYPLHLASMSLACIGIGGCTLSSWLTCRLASYEQR     71 - 140
RMFSEREHSLHHSHEMAEKEITDNMSNGGPQLIFNGRV                                    141 - 178
//

Text Mined References (7)

PMID Year Title