Property Summary

NCBI Gene PubMed Count 7
PubMed Score 13.83
PubTator Score 2.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.600 0.010
oligodendroglioma -1.700 0.009
osteosarcoma 1.569 0.021
ependymoma -1.200 0.000
atypical teratoid / rhabdoid tumor -1.200 0.001
glioblastoma -1.800 0.000
medulloblastoma, large-cell -2.100 0.000
intraductal papillary-mucinous adenoma (... -1.500 0.000
intraductal papillary-mucinous carcinoma... -1.500 0.000
intraductal papillary-mucinous neoplasm ... -1.500 0.003
interstitial cystitis -1.500 0.000
pediatric high grade glioma -1.500 0.000
pilocytic astrocytoma -1.200 0.000
psoriasis -1.400 0.000
lung carcinoma 1.200 0.000
Pick disease -1.100 0.010
Breast cancer -1.700 0.000
pituitary cancer -1.900 0.000

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MPSARGKSKSKAPITFGDLAIYFSQEEWEWLSPIQKDLYEDVMLENYRNLVSLGLSFRRPNVITLLEKGK      1 - 70
APWMVEPVRRRRAPDSGSKCETKKLPPNQCNKSGQSICQKLVSAQQKAPTRKSGCNKNSVLVKPKKGHSG     71 - 140
KKPLKCNDCGKTFSRSFSLKLHQNIHTGEKPFECSNCRKAFRQISSILLHQRIHSGKKSHECNKCGESFN    141 - 210
QRTTLILHMRIHDGKEILDCGKALSQCQSFNIHQKIHVVGNVCQCRKCGKAFNQMSSLLLHKKIHNGKKT    211 - 280
HKYNKCGRGFKKKSVFVVHKRIHAGEKIPENAKALSQSLQQRSHHLENPFKCRKCGKLFNRISPLMLHQR    281 - 350
IHTSEKPYKCDKCDKFFRRLSTLILHLRIHNGEKLYRCNKCEKVCNRHSSLIQHQKVHTKKKKLFECKEC    351 - 420
GKMFSGTANLKIHQNIHSEEKPFKCNKCSKVFGRQSFLIEHQRIHTGEKPYQCEECGKAFSHRISLTRHK    421 - 490
RIHTEDRPYECDQCGKAFSQSAHLAQHERIHTGEKPYTCKTCGKAFSQRTSLILHERSHTGEKPYECNEC    491 - 560
GKAFSSGSDLIRHQRSHSSEKPYECSKCGKAYSRSSSLIRHQNTHSEEKA                        561 - 610
//

Text Mined References (9)

PMID Year Title
25310648 2014 Mipu1 protects H9c2 myogenic cells from hydrogen peroxide-induced apoptosis through inhibition of the expression of the death receptor Fas.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17397802 2007 Functional analysis of a novel KRAB/C2H2 zinc finger protein Mipu1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.