Property Summary

NCBI Gene PubMed Count 8
PubMed Score 14.83
PubTator Score 2.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.300 4.9e-04
astrocytic glioma -1.600 1.0e-02
Astrocytoma, Pilocytic -1.200 5.0e-06
atypical teratoid / rhabdoid tumor -1.200 8.1e-04
Breast cancer -1.700 9.7e-06
ependymoma -1.200 6.2e-07
glioblastoma -1.200 2.1e-03
interstitial cystitis -1.500 4.4e-04
intraductal papillary-mucinous adenoma (... -1.500 1.1e-04
intraductal papillary-mucinous carcinoma... -1.500 3.1e-04
intraductal papillary-mucinous neoplasm ... -1.500 2.8e-03
lung carcinoma 1.200 3.5e-25
medulloblastoma, large-cell -1.500 4.4e-04
oligodendroglioma -1.700 8.8e-03
osteosarcoma 1.569 2.1e-02
Pick disease -1.100 9.9e-03
pituitary cancer -1.900 2.5e-07
psoriasis -1.400 2.5e-14

Gene RIF (2)

AA Sequence

MPSARGKSKSKAPITFGDLAIYFSQEEWEWLSPIQKDLYEDVMLENYRNLVSLGLSFRRPNVITLLEKGK      1 - 70
APWMVEPVRRRRAPDSGSKCETKKLPPNQCNKSGQSICQKLVSAQQKAPTRKSGCNKNSVLVKPKKGHSG     71 - 140
KKPLKCNDCGKTFSRSFSLKLHQNIHTGEKPFECSNCRKAFRQISSILLHQRIHSGKKSHECNKCGESFN    141 - 210
QRTTLILHMRIHDGKEILDCGKALSQCQSFNIHQKIHVVGNVCQCRKCGKAFNQMSSLLLHKKIHNGKKT    211 - 280
HKYNKCGRGFKKKSVFVVHKRIHAGEKIPENAKALSQSLQQRSHHLENPFKCRKCGKLFNRISPLMLHQR    281 - 350
IHTSEKPYKCDKCDKFFRRLSTLILHLRIHNGEKLYRCNKCEKVCNRHSSLIQHQKVHTKKKKLFECKEC    351 - 420
GKMFSGTANLKIHQNIHSEEKPFKCNKCSKVFGRQSFLIEHQRIHTGEKPYQCEECGKAFSHRISLTRHK    421 - 490
RIHTEDRPYECDQCGKAFSQSAHLAQHERIHTGEKPYTCKTCGKAFSQRTSLILHERSHTGEKPYECNEC    491 - 560
GKAFSSGSDLIRHQRSHSSEKPYECSKCGKAYSRSSSLIRHQNTHSEEKA                        561 - 610
//

Text Mined References (10)

PMID Year Title