Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.69
PubTator Score 3.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical carcinoma -1.768 3.6e-04
adult high grade glioma 1.200 6.4e-03
Astrocytoma, Pilocytic 1.300 2.4e-06
atypical teratoid / rhabdoid tumor 1.300 2.0e-03
Breast cancer -1.400 8.0e-14
breast carcinoma -1.500 1.1e-04
cystic fibrosis 1.756 5.2e-06
ductal carcinoma in situ -1.600 5.9e-04
fibroadenoma -1.200 2.0e-02
glioblastoma 1.200 2.6e-03
group 4 medulloblastoma 1.100 4.2e-02
invasive ductal carcinoma -2.400 1.3e-04
juvenile dermatomyositis 1.139 1.0e-11
lung adenocarcinoma -1.100 1.1e-16
lung carcinoma -1.600 2.2e-15
medulloblastoma, large-cell 1.700 2.2e-05
mucosa-associated lymphoid tissue lympho... 1.086 1.6e-02
non-small cell lung cancer -1.167 1.3e-19
ovarian cancer 1.400 1.1e-07
pancreatic cancer 1.200 1.1e-02
pituitary cancer 1.300 3.8e-04
primary pancreatic ductal adenocarcinoma 1.417 1.3e-03
spina bifida -2.427 4.3e-02

Gene RIF (3)

AA Sequence

MNIMNTEQSQNSIVSRIKVFEGQTNIETSGLPKKPEITPRSLPPKPTVSSGKPSVAPKPAANRASGEWDS      1 - 70
GTENRLKVTSKEGLTPYPPLQEAGSIPVTKPELPKKPNPGLIRSVNPEIPGRGPLAESSDSGKKVPTPAP     71 - 140
RPLLLKKSVSSENPTYPSAPLKPVTVPPRLAGASQAKAYKSLGEGPPANPPVPVLQSKPLVDIDLISFDD    141 - 210
DVLPTPSGNLAEESVGSEMVLDPFQLPAKTEPIKERAVQPAPTRKPTVIRIPAKPGKCLHEDPQSPPPLP    211 - 280
AEKPIGNTFSTVSGKLSNVERTRNLESNHPGQTGGFVRVPPRLPPRPVNGKTIPTQQPPTKVPPERPPPP    281 - 350
KLSATRRSNKKLPFNRSSSDMDLQKKQSNLATGLSKAKSQVFKNQDPVLPPRPKPGHPLYSKYMLSVPHG    351 - 420
IANEDIVSQNPGELSCKRGDVLVMLKQTENNYLECQKGEDTGRVHLSQMKIITPLDEHLRSRPNDPSHAQ    421 - 490
KPVDSGAPHAVVLHDFPAEQVDDLNLTSGEIVYLLEKIDTDWYRGNCRNQIGIFPANYVKVIIDIPEGGN    491 - 560
GKRECVSSHCVKGSRCVARFEYIGEQKDELSFSEGEIIILKEYVNEEWARGEVRGRTGIFPLNFVEPVED    561 - 630
YPTSGANVLSTKVPLKTKKEDSGSNSQVNSLPAEWCEALHSFTAETSDDLSFKRGDRIQILERLDSDWCR    631 - 700
GRLQDREGIFPAVFVRPCPAEAKSMLAIVPKGRKAKALYDFRGENEDELSFKAGDIITELESVDDDWMSG    701 - 770
ELMGKSGIFPKNYIQFLQIS                                                      771 - 790
//

Text Mined References (22)

PMID Year Title