Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.84
PubTator Score 3.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.26021559467671E-19
lung carcinoma 2844 2.22072889297407E-15
lung adenocarcinoma 2714 1.45000494464061E-14
Breast cancer 3099 8.01238933053402E-14
juvenile dermatomyositis 1189 1.03498306992493E-11
ovarian cancer 8492 6.29671612161035E-7
pilocytic astrocytoma 3086 2.0936583769192E-6
cystic fibrosis 1670 5.22257254148036E-6
medulloblastoma, large-cell 6234 2.21344454590796E-5
breast carcinoma 1614 1.14705184480474E-4
invasive ductal carcinoma 2950 1.25078908130553E-4
adrenocortical carcinoma 1427 3.59718249175944E-4
pituitary cancer 1972 3.83144909313528E-4
ductal carcinoma in situ 1745 5.94527521079684E-4
primary pancreatic ductal adenocarcinoma 1271 0.00131524687791047
atypical teratoid / rhabdoid tumor 4369 0.00198549582165006
glioblastoma 5572 0.00257418621651672
adult high grade glioma 2148 0.00644770188055009
pancreatic cancer 2300 0.0106443692741878
mucosa-associated lymphoid tissue lymphoma 480 0.0163255304605715
fibroadenoma 557 0.019651250924063
group 4 medulloblastoma 1875 0.0417781701576387
spina bifida 1064 0.0431872851649498

Expression

  Differential Expression (23)

Synonym

Accession Q5HYK7 B7Z296 Q08EK1 Q32N10 Q5U3B8 Q86XB3 Q8N5E7 Q9UFC8
Symbols EBP
EVE1
Kryn
SH3P19

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
C. elegans EggNOG Inparanoid

Gene RIF (3)

PMID Text
17672918 occurrence of an unusual TG 3' splice site in intron 6
15280379 yeast two-hybrid screening using the cytoplasmic domain of ADAM12 as bait identified a protein designated Eve-1. Eve-1 plays a role in positively regulating the activity of ADAMs in the signaling of EGFR-ligand shedding.
14551139 identified and characterized EBP, a novel EEN binding protein that interacts with the SH3 domain of EEN; normally expressed in cytoplasm but recruited to the nucleus by MLL-EEN [EBP]

AA Sequence

MNIMNTEQSQNSIVSRIKVFEGQTNIETSGLPKKPEITPRSLPPKPTVSSGKPSVAPKPAANRASGEWDS      1 - 70
GTENRLKVTSKEGLTPYPPLQEAGSIPVTKPELPKKPNPGLIRSVNPEIPGRGPLAESSDSGKKVPTPAP     71 - 140
RPLLLKKSVSSENPTYPSAPLKPVTVPPRLAGASQAKAYKSLGEGPPANPPVPVLQSKPLVDIDLISFDD    141 - 210
DVLPTPSGNLAEESVGSEMVLDPFQLPAKTEPIKERAVQPAPTRKPTVIRIPAKPGKCLHEDPQSPPPLP    211 - 280
AEKPIGNTFSTVSGKLSNVERTRNLESNHPGQTGGFVRVPPRLPPRPVNGKTIPTQQPPTKVPPERPPPP    281 - 350
KLSATRRSNKKLPFNRSSSDMDLQKKQSNLATGLSKAKSQVFKNQDPVLPPRPKPGHPLYSKYMLSVPHG    351 - 420
IANEDIVSQNPGELSCKRGDVLVMLKQTENNYLECQKGEDTGRVHLSQMKIITPLDEHLRSRPNDPSHAQ    421 - 490
KPVDSGAPHAVVLHDFPAEQVDDLNLTSGEIVYLLEKIDTDWYRGNCRNQIGIFPANYVKVIIDIPEGGN    491 - 560
GKRECVSSHCVKGSRCVARFEYIGEQKDELSFSEGEIIILKEYVNEEWARGEVRGRTGIFPLNFVEPVED    561 - 630
YPTSGANVLSTKVPLKTKKEDSGSNSQVNSLPAEWCEALHSFTAETSDDLSFKRGDRIQILERLDSDWCR    631 - 700
GRLQDREGIFPAVFVRPCPAEAKSMLAIVPKGRKAKALYDFRGENEDELSFKAGDIITELESVDDDWMSG    701 - 770
ELMGKSGIFPKNYIQFLQIS                                                      771 - 790
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21834987 2011 Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
17116749 2006 Comparative proteomics of clathrin-coated vesicles.
16858696 2006 Identification of novel Runx1 (AML1) translocation partner genes SH3D19, YTHDf2, and ZNF687 in acute myeloid leukemia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...