Property Summary

NCBI Gene PubMed Count 10
PubMed Score 14.71
PubTator Score 2.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 0.0
Disease Target Count P-value
acute myeloid leukemia 783 2.0e-02
Disease Target Count Z-score Confidence
Early myoclonic encephalopathy 15 3.251 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia -1.100 2.0e-02

Gene RIF (3)

AA Sequence

MAAPGSCALWSYCGRGWSRAMRGCQLLGLRSSWPGDLLSARLLSQEKRAAETHFGFETVSEEEKGGKVYQ      1 - 70
VFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMHPLPGTQLLDVAGGTGDIAFRFLNYVQSQHQRKQKRQL     71 - 140
RAQQNLSWEEIAKEYQNEEDSLGGSRVVVCDINKEMLKVGKQKALAQGYRAGLAWVLGDAEELPFDDDKF    141 - 210
DIYTIAFGIRNVTHIDQALQEAHRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKS    211 - 280
YQYLVESIRRFPSQEEFKDMIEDAGFHKVTYESLTSGIVAIHSGFKL                           281 - 327
//

Text Mined References (14)

PMID Year Title