Property Summary

NCBI Gene PubMed Count 8
PubMed Score 23.13
PubTator Score 3.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy -1.386 2.2e-02
limb girdle muscular dystrophy 2A -1.343 1.2e-02
osteosarcoma -1.058 7.3e-03
psoriasis 1.600 2.5e-06

Gene RIF (4)

AA Sequence

MFKRHKSLASERKRALLSQRATRFILKDDMRNFHFLSKLVLSAGPLRPTPAVKHSKTTHFEIEIFDAQTR      1 - 70
KQICILDKVTQSSTIHDVKQKFHKACPKWYPSRVGLQLECGGPFLKDYITIQSIAASSIVTLYATDLGQQ     71 - 140
VSWTTVFLAEYTGPLLIYLLFYLRIPCIYDGKESARRLRHPVVHLACFCHCIHYIRYLLETLFVHKVSAG    141 - 210
HTPLKNLIMSCAFYWGFTSWIAYYINHPLYTPPSFGNRQITVSAINFLICEAGNHFINVMLSHPNHTGNN    211 - 280
ACFPSPNYNPFTWMFFLVSCPNYTYEIGSWISFTVMTQTLPVGIFTLLMSIQMSLWAQKKHKIYLRKFNS    281 - 350
YIHRKSAMIPFIL                                                             351 - 363
//

Text Mined References (11)

PMID Year Title