Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.11
PubTator Score 1.75

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.300 2.5e-06
non-small cell lung cancer 1.009 1.8e-15
osteosarcoma -1.251 1.5e-03
pancreatic ductal adenocarcinoma liver m... -1.418 1.1e-02
tuberculosis -1.200 1.2e-05

Synonym

Accession Q5HYI8 Q8WUD3
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 Compartment GO Term (1)

Gene RIF (4)

AA Sequence

MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTYYIELWDVGGS      1 - 70
VGSASSVKSTRAVFYNSVNGIIFVHDLTNKKSSQNLRRWSLEALNRDLVPTGVLVTNGDYDQEQFADNQI     71 - 140
PLLVIGTKLDQIHETKRHEVLTRTAFLAEDFNPEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFL    141 - 210
REGNQIPGFPDRKRFGAGTLKSLHYD                                                211 - 236
//

Text Mined References (12)

PMID Year Title