Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.61
PubTator Score 1.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
osteosarcoma -1.251 0.002
pancreatic ductal adenocarcinoma liver m... -1.418 0.011
tuberculosis -1.200 0.000
non-small cell lung cancer 1.009 0.000

Synonym

Accession Q5HYI8 Q8WUD3
Symbols

Gene

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
20596630 Rabl3 can be considered as a novel candidate in the control of tumorigenesis and as a new target for anticancer treatment.

AA Sequence

MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTYYIELWDVGGS      1 - 70
VGSASSVKSTRAVFYNSVNGIIFVHDLTNKKSSQNLRRWSLEALNRDLVPTGVLVTNGDYDQEQFADNQI     71 - 140
PLLVIGTKLDQIHETKRHEVLTRTAFLAEDFNPEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFL    141 - 210
REGNQIPGFPDRKRFGAGTLKSLHYD                                                211 - 236
//

Text Mined References (9)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21269460 2011 Initial characterization of the human central proteome.
20596630 2010 Evaluation of the novel gene Rabl3 in the regulation of proliferation and motility in human cancer cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.