Property Summary

NCBI Gene PubMed Count 3
PubMed Score 21.08
PubTator Score 14.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.086 0.000
juvenile dermatomyositis 1.147 0.000
tuberculosis and treatment for 6 months 1.300 0.000
ovarian cancer -1.300 0.000

Synonym

Accession Q5HYI7 B4DL65 E9PB57 Q7Z380 Q8NB92
Symbols

Gene

AA Sequence

MAAPLELSCWGGGWGLPSVHSESLVVMAYAKFSGAPLKVNVIDNTWRGSRGDVPILTTEDDMVSQPAKIL      1 - 70
NFLRKQKYNADYELSAKQGADTLAYIALLEEKLLPAVLHTFWVESDNYFTVTKPWFASQIPFPLSLILPG     71 - 140
RMSKGALNRILLTRGQPPLYHLREVEAQIYRDAKECLNLLSNRLGTSQFFFGDTPSTLDAYVFGFLAPLY    141 - 210
KVRFPKVQLQEHLKQLSNLCRFCDDILSSYFRLSLGGISPAGQETVDANLQKLTQLVNKESNLIEKMDDN    211 - 280
LRQSPQLPPRKLPTLKLTPAEEENNSFQRLSP                                          281 - 312
//

Text Mined References (9)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15087125 2004 The zebrafish metaxin 3 gene (mtx3): cDNA and protein structure, and comparison to zebrafish metaxins 1 and 2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.