Property Summary

NCBI Gene PubMed Count 3
PubMed Score 25.74
PubTator Score 14.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
juvenile dermatomyositis 1.147 1.9e-08
osteosarcoma 1.086 2.2e-05
ovarian cancer -1.300 9.0e-05
tuberculosis and treatment for 6 months 1.300 3.4e-05

AA Sequence

MAAPLELSCWGGGWGLPSVHSESLVVMAYAKFSGAPLKVNVIDNTWRGSRGDVPILTTEDDMVSQPAKIL      1 - 70
NFLRKQKYNADYELSAKQGADTLAYIALLEEKLLPAVLHTFWVESDNYFTVTKPWFASQIPFPLSLILPG     71 - 140
RMSKGALNRILLTRGQPPLYHLREVEAQIYRDAKECLNLLSNRLGTSQFFFGDTPSTLDAYVFGFLAPLY    141 - 210
KVRFPKVQLQEHLKQLSNLCRFCDDILSSYFRLSLGGISPAGQETVDANLQKLTQLVNKESNLIEKMDDN    211 - 280
LRQSPQLPPRKLPTLKLTPAEEENNSFQRLSP                                          281 - 312
//

Text Mined References (10)

PMID Year Title