Property Summary

NCBI Gene PubMed Count 27
PubMed Score 36.33
PubTator Score 27.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Nephronophthisis 80 5.631 2.8
Intellectual disability 1016 0.0 4.0
Obesity 678 0.0 4.0

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.400 3.1e-05
Astrocytoma, Pilocytic 1.200 1.0e-06
atypical teratoid / rhabdoid tumor 2.200 1.6e-10
chronic rhinosinusitis -1.182 3.2e-02
ependymoma 1.800 2.9e-02
glioblastoma 1.400 7.0e-09
group 3 medulloblastoma 1.400 6.0e-04
medulloblastoma, large-cell 1.600 4.6e-05
non primary Sjogren syndrome sicca -1.300 2.2e-02
osteosarcoma -1.328 5.1e-06
ovarian cancer -1.100 4.3e-08
primitive neuroectodermal tumor 1.300 2.3e-03

Gene RIF (17)

AA Sequence

MATRGGAGVAMAVWSLLSARAVTAFLLLFLPRFLQAQTFSFPFQQPEKCDNNQYFDISALSCVPCGANQR      1 - 70
QDARGTSCVCLPGFQMISNNGGPAIICKKCPENMKGVTEDGWNCISCPSDLTAEGKCHCPIGHILVERDI     71 - 140
NGTLLSQATCELCDGNENSFMVVNALGDRCVRCEPTFVNTSRSCACSEPNILTGGLCFSSTGNFPLRRIS    141 - 210
AARYGEVGMSLTSEWFAKYLQSSAAACWVYANLTSCQALGNMCVMNMNSYDFATFDACGLFQFIFENTAG    211 - 280
LSTVHSISFWRQNLPWLFYGDQLGLAPQVLSSTSLPTNFSFKGENQNTKLKFVAASYDIRGNFLKWQTLE    281 - 350
GGVLQLCPDTETRLNAAYSFGTTYQQNCEIPISKILIDFPTPIFYDVYLEYTDENQHQYILAVPVLNLNL    351 - 420
QHNKIFVNQDSNSGKWLLTRRIFLVDAVSGRENDLGTQPRVIRVATQISLSVHLVPNTINGNIYPPLITI    421 - 490
AYSDIDIKDANSQSVKVSFSVTYEMDHGEAHVQTDIALGVLGGLAVLASLLKTAGWKRRIGSPMIDLQTV    491 - 560
VKFLVYYAGDLANVFFIITVGTGLYWLIFFKAQKSVSVLLPMPIQEERFVTYVGCAFALKALQFLHKLIS    561 - 630
QITIDVFFIDWERPKGKVLKAVEGEGGVRSATVPVSIWRTYFVANEWNEIQTVRKINSLFQVLTVLFFLE    631 - 700
VVGFKNLALMDSSSSLSRNPPSYIAPYSCILRYAVSAALWLAIGIIQVVFFAVFYERFIEDKIRQFVDLC    701 - 770
SMSNISVFLLSHKCFGYYIHGRSVHGHADTNMEEMNMNLKREAENLCSQRGLVPNTDGQTFEIAISNQMR    771 - 840
QHYDRIHETLIRKNGPARLLSSSASTFEQSIKAYHMMNKFLGSFIDHVHKEMDYFIKDKLLLERILGMEF    841 - 910
MEPMEKSIFYNDEGYSFSSVLYYGNEATLLIFDLLFFCVVDLACQNFILASFLTYLQQEIFRYIRNTVGQ    911 - 980
KNLASKTLVDQRFLI                                                           981 - 995
//

Text Mined References (30)

PMID Year Title