Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.83
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.700 5.3e-05
Astrocytoma, Pilocytic 1.200 9.2e-06
atypical teratoid / rhabdoid tumor 1.100 1.0e-04
cystic fibrosis 1.300 2.1e-02
diabetes mellitus -1.100 8.0e-03
ependymoma 1.300 1.6e-05
glioblastoma 1.300 2.3e-08
intraductal papillary-mucinous adenoma (... 2.200 2.0e-04
intraductal papillary-mucinous carcinoma... 1.500 5.4e-03
intraductal papillary-mucinous neoplasm ... 2.000 4.6e-03
juvenile dermatomyositis 2.083 2.0e-15
lung carcinoma -2.000 3.2e-21
nasopharyngeal carcinoma 1.200 1.6e-03
osteosarcoma -1.440 7.8e-03
ovarian cancer -1.200 1.3e-02
pancreatic cancer 1.100 8.8e-05
primary Sjogren syndrome 1.900 2.7e-05
psoriasis 1.600 1.6e-10
Rheumatoid arthritis 1.300 8.4e-03
subependymal giant cell astrocytoma 3.082 1.2e-02
tuberculosis and treatment for 3 months -1.400 9.6e-04

Gene RIF (2)

AA Sequence

MGSKDHAVFFREMTQLILNEMPKAGYSSILNDFVESNFFVIDGDSLLVTCLGVKSFKWGQNLHFFYLVEC      1 - 70
YLVDLLSNGGQFTIVFFKDAEYAYFDFPELLSLRTALILHLQHNTNIDVQTEFSGCLSQDWKLFLEQHYP     71 - 140
YFLIVSEEGLSDLQTYLFNFLIIHSWGMKVNVVLSSGHESDTLRFYAYTMESTDRNQTFSKENETVIQSA    141 - 210
YKSLIQHLEEIRVLVLATHFEHLKWNDMMEEAYQTLFLLQHLWSEGSDIQRVLCVTSCSLSLRMYHRVLV    211 - 280
HSNCLSLQEVEDFCRLRCLCVAFQLHLPLSQRACSRVITCSWIRNSDSFLKMNKWCEYFILSNLNVFGCW    281 - 350
NLNLNHVSDLYDEQLLKNIAFYYEFESTQEPHLNLGDSIRRDYEDLWNVVSHLVKEFNVGKSFPLRTTRR    351 - 420
HFLRQEKSVIQEISLEKMPSVGFIPMTSAVIDEFVGDMMKDLPILKSDDPVVPSLFKQKTSDELLHWHAQ    421 - 490
RLLSDDYDRIKCHVDEQSRDPHVLDFLKKIQDYQQFYGKSLESISTKVIVTQTTRPKEDSSGASGEILQN    491 - 560
TKPHQITKKSKKKSFLKEDQNKAQQNDDLLFSIEEEMKNNLHSGIRKLEDYLTSCASNSVKFGVEMLGLI    561 - 630
ACFKAWKKHCRGEGKISKDLSIAVQMMKRIHSLLERYPEILEAEHHQYIAKCLKYLGFNDLANSLDPTLI    631 - 700
GDDKNKKKYSIDIGPARFQLQYMGHYLIRDERKDRDPRVQDFIPNAWQQELLDVVDKNESAVIVAPTSSG    701 - 770
KTYASYYCMEKVLRESDVGVVVYVAPAKSLVGQVAATVENRFTKTLPAGRTLCGAFTRDYCHNVLNCQVL    771 - 840
ITVPECFEILLLAPHRQKWVERIRYVIFDEVHYLGREVGAKFWELLLVIIRCPFLVLSATINNPNLLTKW    841 - 910
LQSVKQYWKQADKIMEEKCISEKQADKCLNFLQDHSYKNQSYEVRLVLYGERYNDLEKHICSVKHDDVYF    911 - 980
DHFHPCAALTTDIIEKYGFPPDLTLTPQESIQLYDTMAQVWETWPRAQELCPEEFILFKNKIVIKKLDAR    981 - 1050
KYEENLKAELTNWIKNGQVKKVKRVLKNLSPDSLSSSKDMVKMFPLLVEKLRQMDKLPAIFFLFKNDDVG   1051 - 1120
KRAGSVCTFLEKTETKSHPHTECHSYVFAIDEVLEKVRKTQKRITKKNPKKAEKLERKKVYRAEYINFLE   1121 - 1190
NLKILEISEDCTYADVKALHTEITRNKDSTLERVLPRVRFTRHGKELKALAQRGIGYHHSSMYFKEKEFV   1191 - 1260
EILFVKGLIRVVTATETLALGIHMPCKSVVFAQDSVYLDALNYRQMSGRAGRRGQDLLGNVYFFDIPLPK   1261 - 1330
IKRLLASSVPELRGQFPLSITLVLRLMLLASKGDDPEDAKAKVLSVLKHSLLSFKRRRAMETLKLYFLFS   1331 - 1400
LQLLIKEDYLNKKGNPKKFAGLASYLHGHEPSNLVFVNFLKRGLFHNLCKPAWKGSQQFSQDVMEKLVLV   1401 - 1470
LANLFGRKYIPAKFQNANLSFSQSKVILAELPEDFKAALYEYNLAVMKDFASFLLIASKSVNMKKEHQLP   1471 - 1540
LSRIKFTGKECEDSQLVSHLMSCKKGRVAISPFVCLSGNTDNDLLRPETINQVILRTVGVSGTQAPLLWP   1541 - 1610
WKLDNRGRRMPLNAYVLNFYKHNCLTRLDQKNGMRMGQLLKCLKDFAFNIQAISDSLSELCENKRDNVVL   1611 - 1680
AFKQLSQTFYEKLQEMQIQMSQNHLE                                               1681 - 1706
//

Text Mined References (7)

PMID Year Title