Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.18
PubTator Score 0.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 9.19960586120358E-21
ovarian cancer 8492 1.04868401953731E-19
atypical teratoid / rhabdoid tumor 4369 7.91815343101086E-9
medulloblastoma 1524 7.09751711058897E-7
adrenocortical carcinoma 1427 2.48689376398857E-6
adrenocortical adenoma 134 1.46529103896614E-5
primitive neuroectodermal tumor 3031 8.98338420184957E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.03237382260956E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 8.09527406040786E-4
astrocytic glioma 2241 0.00110852325559143
acute quadriplegic myopathy 1157 0.00122245746044341
ependymoma 2514 0.00130171290637858
pancreatic cancer 2300 0.00213850994239182
glioblastoma 5572 0.00268145801087814
oligodendroglioma 2849 0.00333647749221415
interstitial cystitis 2299 0.00541456950364547
medulloblastoma, large-cell 6234 0.00590266989593867
adult high grade glioma 2148 0.00786739889007919
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0123684465102488
gastric carcinoma 832 0.0232421550419849
spina bifida 1064 0.0358850273591566
Disease Target Count Z-score Confidence
Pancreatitis 97 0.0 1.0
Disease Target Count Z-score Confidence
Synovial sarcoma 25 3.549 1.8

Expression

  Differential Expression (21)

AA Sequence

MESEYVLCNWKDQLWPAKVLSRSETSSNSKRKKAFSLEVQILSLDEKIKLDSTETKILNKSQIEAIAASL      1 - 70
GLQSEDSAPPTEETAYGRSLKVALGILNERTNLSQASTSDEEEITMLSQNVPQKQSDSPPHKKYRKDEGD     71 - 140
LPGCLEERENSACLLASSESDDSLYDDKSQAPTMVDTIPSEVETKSLQNSSWCETFPSLSEDNDEKENKN    141 - 210
KIDISAVMSVHSAVKEESACVKDEKFAPPLSPLSSDMLIMPKALKEESEDTCLETLAVPSECSAFSENIE    211 - 280
DPGEGPSNPCLDTSQNQPSMESEMGAAACPGSCSRECEVSFSASNPVWDYSHLMSSERNFQRLDFEELEE    281 - 350
EGQASDKSLLPSRINLSLLDDDEEDEELPRFILHYETHPFETGMIVWFKYQKYPFWPAVIKSIRRKERKA    351 - 420
SVLFVEANMNSEKKGIRVNFRRLKKFDCKEKQMLVDKAREDYSESIDWCISLICDYRVRIGCGSFTGSLL    421 - 490
EYYAADISYPVRKETKQDTFRNKFPKLHNEDAREPMAVTSQTKKMSFQKILPDRMKAARDRANKNLVDFI    491 - 560
VNAKGTENHLLAIVNGTKGSRWLKSFLNANRFTPCIETYFEDEDQLDEVVKYLQEVCNQIDQIMPTWIKD    561 - 630
DKIKFILEVLLPEAIICSISAVDGLDYEAAEAKYLKGPCLGYRERELFDAKIIYEKRRKAPTNEAH        631 - 696
//

Text Mined References (8)

PMID Year Title
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.