Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.27
PubTator Score 0.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.015 1.2e-03
adrenocortical adenoma -2.260 1.5e-05
adrenocortical carcinoma -2.272 2.5e-06
adult high grade glioma -2.500 7.9e-03
astrocytic glioma -3.100 1.1e-03
atypical teratoid / rhabdoid tumor -3.900 7.9e-09
ependymoma -3.500 1.3e-03
gastric carcinoma -1.400 2.3e-02
glioblastoma -2.100 6.9e-04
group 3 medulloblastoma -3.100 1.5e-02
interstitial cystitis -1.400 5.4e-03
intraductal papillary-mucinous adenoma (... -2.100 1.2e-02
intraductal papillary-mucinous carcinoma... -3.600 1.0e-04
intraductal papillary-mucinous neoplasm ... -3.300 8.1e-04
medulloblastoma, large-cell -3.400 5.9e-03
oligodendroglioma -3.000 3.3e-03
ovarian cancer -5.700 1.0e-19
pancreatic cancer -1.300 2.1e-03
primitive neuroectodermal tumor -4.100 9.0e-05
psoriasis -2.000 9.2e-21
spina bifida -1.651 3.6e-02

AA Sequence

MESEYVLCNWKDQLWPAKVLSRSETSSNSKRKKAFSLEVQILSLDEKIKLDSTETKILNKSQIEAIAASL      1 - 70
GLQSEDSAPPTEETAYGRSLKVALGILNERTNLSQASTSDEEEITMLSQNVPQKQSDSPPHKKYRKDEGD     71 - 140
LPGCLEERENSACLLASSESDDSLYDDKSQAPTMVDTIPSEVETKSLQNSSWCETFPSLSEDNDEKENKN    141 - 210
KIDISAVMSVHSAVKEESACVKDEKFAPPLSPLSSDMLIMPKALKEESEDTCLETLAVPSECSAFSENIE    211 - 280
DPGEGPSNPCLDTSQNQPSMESEMGAAACPGSCSRECEVSFSASNPVWDYSHLMSSERNFQRLDFEELEE    281 - 350
EGQASDKSLLPSRINLSLLDDDEEDEELPRFILHYETHPFETGMIVWFKYQKYPFWPAVIKSIRRKERKA    351 - 420
SVLFVEANMNSEKKGIRVNFRRLKKFDCKEKQMLVDKAREDYSESIDWCISLICDYRVRIGCGSFTGSLL    421 - 490
EYYAADISYPVRKETKQDTFRNKFPKLHNEDAREPMAVTSQTKKMSFQKILPDRMKAARDRANKNLVDFI    491 - 560
VNAKGTENHLLAIVNGTKGSRWLKSFLNANRFTPCIETYFEDEDQLDEVVKYLQEVCNQIDQIMPTWIKD    561 - 630
DKIKFILEVLLPEAIICSISAVDGLDYEAAEAKYLKGPCLGYRERELFDAKIIYEKRRKAPTNEAH        631 - 696
//

Text Mined References (8)

PMID Year Title