Property Summary

NCBI Gene PubMed Count 10
PubMed Score 20.04
PubTator Score 11.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
medulloblastoma 1524 6.36780032963882E-5
pilocytic astrocytoma 3086 0.00377112426910884
medulloblastoma, large-cell 6234 0.00833832971506364
primitive neuroectodermal tumor 3031 0.0134543947093296
ependymoma 2514 0.0252340049859616
oligodendroglioma 2849 0.0328134724390818
astrocytic glioma 2241 0.0381216221652073
glioblastoma 5572 0.0389279911973434
psoriasis 6685 0.0432190741110367

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.300 0.038
ependymoma -1.300 0.025
oligodendroglioma -1.400 0.033
psoriasis -1.100 0.043
medulloblastoma -1.600 0.000
glioblastoma -1.100 0.039
medulloblastoma, large-cell -1.800 0.008
primitive neuroectodermal tumor -1.700 0.013
pilocytic astrocytoma -1.100 0.004

Synonym

Accession Q5H9L4 Q5H9L6 Q86XI4 Q9BXU5 Q9H5R0
Symbols CT40
TAF2Q

Gene

PANTHER Protein Class (1)

  Ortholog (6)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA Inparanoid
Cow OMA Inparanoid

Gene RIF (5)

PMID Text
26107214 Over-expression of TAF7L was observed in breast tumor cell lines.
25098277 Frameshift mutations of TAF7L gene is associated with stomach and colorectal cancers.
23292864 expression of AURKC, OIP5, PIWIL2 and TAF7L differed between patients with Acute myeloid leukemia, myelodysplastic syndrome and healthy controls in a gender-dependent manner
17714218 The sequence variant in exon 13 of the TAF7L gene located on the X chromosome may represent a risk factor for spermatogenic failure.
16597641 TAF7L gene polymorphisms were found in male infertility patients and normal controls.

AA Sequence

MECPEGQLPISSENDSTPTVSTSEVTSQQEPQILVDRGSETTYESSADIAGDEGTQIPADEDTQTDADSS      1 - 70
AQAAAQAPENFQEGKDMSESQDEVPDEVENQFILRLPLEHACTVRNLARSQSVKMKDKLKIDLLPDGRHA     71 - 140
VVEVEDVPLAAKLVDLPCVIESLRTLDKKTFYKTADISQMLVCTADGDIHLSPEEPAASTDPNIVRKKER    141 - 210
GREEKCVWKHGITPPLKNVRKKRFRKTQKKVPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAVSTRW    211 - 280
EVIAEDGTKEIESQGSIPGFLISSGMSSHKQGHTSSEYDMLREMFSDSRSNNDDDEDEDDEDEDEDEDED    281 - 350
EDEDKEEEEEDCSEEYLERQLQAEFIESGQYRANEGTSSIVMEIQKQIEKKEKKLHKIQNKAQRQKDLIM    351 - 420
KVENLTLKNHFQSVLEQLELQEKQKNEKLISLQEQLQRFLKK                                421 - 462
//

Text Mined References (13)

PMID Year Title
26107214 2015 Cancer/Testis OIP5 and TAF7L Genes are Up-Regulated in Breast Cancer.
25098277 2015 Frameshift mutations of TAF7L gene, a core component for transcription by RNA polymerase II, in colorectal cancers.
23292864 2013 Expression analysis of four testis-specific genes AURKC, OIP5, PIWIL2 and TAF7L in acute myeloid leukemia: a gender-dependent expression pattern.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17714218 2007 Mutation analysis of the X-chromosome linked, testis-specific TAF7L gene in spermatogenic failure.
16597641 2006 The role of the testis-specific gene hTAF7L in the aetiology of male infertility.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...