Property Summary

NCBI Gene PubMed Count 10
PubMed Score 22.56
PubTator Score 11.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.100 2.6e-02
Astrocytoma, Pilocytic -1.100 3.8e-03
ependymoma -1.300 2.5e-02
glioblastoma -1.100 3.9e-02
group 3 medulloblastoma -1.400 4.5e-02
medulloblastoma, large-cell -1.800 8.3e-03
oligodendroglioma -1.300 1.3e-02
primitive neuroectodermal tumor -1.700 1.3e-02
psoriasis -1.100 4.3e-02

Gene RIF (5)

AA Sequence

MECPEGQLPISSENDSTPTVSTSEVTSQQEPQILVDRGSETTYESSADIAGDEGTQIPADEDTQTDADSS      1 - 70
AQAAAQAPENFQEGKDMSESQDEVPDEVENQFILRLPLEHACTVRNLARSQSVKMKDKLKIDLLPDGRHA     71 - 140
VVEVEDVPLAAKLVDLPCVIESLRTLDKKTFYKTADISQMLVCTADGDIHLSPEEPAASTDPNIVRKKER    141 - 210
GREEKCVWKHGITPPLKNVRKKRFRKTQKKVPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAVSTRW    211 - 280
EVIAEDGTKEIESQGSIPGFLISSGMSSHKQGHTSSEYDMLREMFSDSRSNNDDDEDEDDEDEDEDEDED    281 - 350
EDEDKEEEEEDCSEEYLERQLQAEFIESGQYRANEGTSSIVMEIQKQIEKKEKKLHKIQNKAQRQKDLIM    351 - 420
KVENLTLKNHFQSVLEQLELQEKQKNEKLISLQEQLQRFLKK                                421 - 462
//

Text Mined References (13)

PMID Year Title