Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 1.9e-28
psoriasis 6694 3.8e-20
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 1.300 1.9e-28
psoriasis -1.600 3.8e-20

AA Sequence

MEKLYKENEGKPENERNLESEGKPEDEGSTEDEGKSDEEEKPDMEGKTECEGKREDEGEPGDEGQLEDEG      1 - 70
NQEKQGKSEGEDKPQSEGKPASQAKPESQPRAAEKRPAEDYVPRKAKRKTDRGTDDSPKDSQEDLQERHL     71 - 140
SSEEMMRECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAPRGQRGVRGVRGGGRGQKDLEDVPYV        141 - 206
//

Text Mined References (6)

PMID Year Title