Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q5H9J9
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source
Chicken OMA Inparanoid

 Compartment GO Term (1)

AA Sequence

MYNAFWNHLKEQLLSTPPDFTCALELLKDVKENRLRNEIEEALDTDLLKQEAEHGALDVPHLSNYILNLM      1 - 70
ALLCAPVRDEAIQKLETIRDPVQLLRGILRVLGLMKMDMVNYTIQSFRPYLQEHSIQYEQAKFQELLDKQ     71 - 140
PSLLDYTTKWLTKAATDITTLCPSSPDSPSSSCSMACSLPSGAGNNSEPPSPTMVLYQGYLNLLLWDLEN    141 - 210
VEFPETLLMDRIRLQELAFQLHQLTVLASVLLVARSFSGEVLFRSPEFVDRLKCTTKALTEEFISRPEET    211 - 280
MLSVSEQVSQEVHQGLKDMGLTTLSSENTASLLGQLQNITKKENCIRSIVDQWIRFFLKCCLLHGMQESL    281 - 350
LHFPGGLILIEKELAELGWKFLNLMHHNQQVFGPYYAEILKHIIHPAQAQETDVEPN                 351 - 407
//

Text Mined References (3)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11566096 2001 NXF5, a novel member of the nuclear RNA export factor family, is lost in a male patient with a syndromic form of mental retardation.