Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q5H9J9
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Inparanoid OMA

 Compartment GO Term (1)

AA Sequence

MYNAFWNHLKEQLLSTPPDFTCALELLKDVKENRLRNEIEEALDTDLLKQEAEHGALDVPHLSNYILNLM      1 - 70
ALLCAPVRDEAIQKLETIRDPVQLLRGILRVLGLMKMDMVNYTIQSFRPYLQEHSIQYEQAKFQELLDKQ     71 - 140
PSLLDYTTKWLTKAATDITTLCPSSPDSPSSSCSMACSLPSGAGNNSEPPSPTMVLYQGYLNLLLWDLEN    141 - 210
VEFPETLLMDRIRLQELAFQLHQLTVLASVLLVARSFSGEVLFRSPEFVDRLKCTTKALTEEFISRPEET    211 - 280
MLSVSEQVSQEVHQGLKDMGLTTLSSENTASLLGQLQNITKKENCIRSIVDQWIRFFLKCCLLHGMQESL    281 - 350
LHFPGGLILIEKELAELGWKFLNLMHHNQQVFGPYYAEILKHIIHPAQAQETDVEPN                 351 - 407
//

Text Mined References (3)

PMID Year Title