Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.80
PubTator Score 1.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
acute myeloid leukemia -3.300 1.1e-04
adult high grade glioma -4.000 3.7e-06
aldosterone-producing adenoma -1.055 1.4e-02
astrocytic glioma -4.100 1.9e-03
Astrocytoma, Pilocytic -1.300 4.3e-03
atypical teratoid / rhabdoid tumor -4.100 5.7e-06
Breast cancer 2.900 2.9e-02
ependymoma -5.400 1.1e-03
glioblastoma -2.800 3.5e-07
group 3 medulloblastoma -2.900 9.5e-04
intraductal papillary-mucinous adenoma (... -1.400 2.6e-03
intraductal papillary-mucinous carcinoma... -2.100 3.7e-03
intraductal papillary-mucinous neoplasm ... -3.900 2.9e-03
medulloblastoma, large-cell -5.800 3.0e-08
non primary Sjogren syndrome sicca 1.100 2.5e-02
non-small cell lung cancer -1.138 4.4e-05
oligodendroglioma -3.200 1.1e-02
ovarian cancer -3.200 6.5e-08
pancreatic cancer -1.100 1.0e-02
Pick disease -1.500 2.7e-03
Pneumonia -1.200 2.0e-03
primitive neuroectodermal tumor -2.600 6.7e-03
psoriasis -1.100 5.7e-24
sarcoidosis -1.100 3.2e-05
subependymal giant cell astrocytoma -3.993 8.7e-03

AA Sequence

MENVPKENKVVEKAPVQNEAPALGGGEYQEPGGNVKGVWAPPAPGFGEDVPNRLVDNIDMIDGDGDDMER      1 - 70
FMEEMRELRRKIRELQLRYSLRILIGDPPHHDHHDEFCLMP                                  71 - 111
//

Text Mined References (8)

PMID Year Title