Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.75
PubTator Score 1.90

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MENVPKENKVVEKAPVQNEAPALGGGEYQEPGGNVKGVWAPPAPGFGEDVPNRLVDNIDMIDGDGDDMER      1 - 70
FMEEMRELRRKIRELQLRYSLRILIGDPPHHDHHDEFCLMP                                  71 - 111
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
18236150 2008 Adaptive evolution and frequent gene conversion in the brain expressed X-linked gene family in mammals.
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
15958283 2005 Characterization of the Bex gene family in humans, mice, and rats.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.