Property Summary

NCBI Gene PubMed Count 9
Grant Count 8
Funding $637,991.19
PubMed Score 194.47
PubTator Score 3.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (5)

PMID Text
24406621 TFDP3 was highly expressed in cancer tissues including prostate cancer tissues.TFDP3 was expressed in coordination with E2F1 in most prostate cancer tissues.
23212661 Data gathered from cell lines, tumorigenicity studies, and primary hepatocellular carcinoma samples demonstrate a negative role of HIF-2alpha in tumors, which is mediated by the TFDP3/E2F1 pathway.
22482402 Data show that TFDP3 upregulates the expression of autophagy gene LC3B and inhibits E2F1-induced apoptosis, and may play an important role in prostate cancer.
20559320 DP-4 downregulating E2F-1 activity and contributes to a new pRb-independent mechanism for regulating cell cycle progression.
17062573 TFDP3, a novel DP protein, inhibits DNA binding and transactivation by E2F

AA Sequence

MAKYVSLTEANEELKVLMDENQTSRPVAVHTSTVNPLGKQLLPKTFGQSSVNIDQQVVIGMPQRPAASNI      1 - 70
PVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWETVQRKGTTSCQEVVGELVAK     71 - 140
FRAASNHASPNESAYDVKNIKRRTYDALNVLMAMNIISREKKKIKWIGLTTNSAQNCQNLRVERQKRLER    141 - 210
IKQKQSELQQLILQQIAFKNLVLRNQYVEEQVSQRPLPNSVIHVPFIIISSSKKTVINCSISDDKSEYLF    211 - 280
KFNSSFEIHDDTEVLMWMGMTFGLESGSCSAEDLKMARNLVPKALEPYVTEMAQGTFGGVFTTAGSRSNG    281 - 350
TWLSASDLTNIAIGMLATSSGGSQYSGSRVETPAVEEEEEEDNNDDDLSENDEDD                   351 - 405
//

Text Mined References (10)

PMID Year Title
24406621 2014 TFDP3 was expressed in coordination with E2F1 to inhibit E2F1-mediated apoptosis in prostate cancer.
23212661 2013 Hypoxia inducible factor 2 alpha inhibits hepatocellular carcinoma growth through the transcription factor dimerization partner 3/ E2F transcription factor 1-dependent apoptotic pathway.
22482402 2012 [Effects of TFDP3 on regulating the autophagy and apoptosis of LNCaP cells].
20559320 2011 E2F-1 regulation by an unusual DNA damage-responsive DP partner subunit.
17632080 2007 TFDP3 inhibits E2F1-induced, p53-mediated apoptosis.
17062573 2007 Human TFDP3, a novel DP protein, inhibits DNA binding and transactivation by E2F.
16418725 2006 A functionally distinct member of the DP family of E2F subunits.
15772651 2005 The DNA sequence of the human X chromosome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12097419 2002 Large scale identification of human hepatocellular carcinoma-associated antigens by autoantibodies.