Property Summary

NCBI Gene PubMed Count 11
PubMed Score 219.22
PubTator Score 3.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Malignant hyperthermia 26 4.549 2.3
Cancer 2499 3.222 1.6

Gene RIF (7)

AA Sequence

MAKYVSLTEANEELKVLMDENQTSRPVAVHTSTVNPLGKQLLPKTFGQSSVNIDQQVVIGMPQRPAASNI      1 - 70
PVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWETVQRKGTTSCQEVVGELVAK     71 - 140
FRAASNHASPNESAYDVKNIKRRTYDALNVLMAMNIISREKKKIKWIGLTTNSAQNCQNLRVERQKRLER    141 - 210
IKQKQSELQQLILQQIAFKNLVLRNQYVEEQVSQRPLPNSVIHVPFIIISSSKKTVINCSISDDKSEYLF    211 - 280
KFNSSFEIHDDTEVLMWMGMTFGLESGSCSAEDLKMARNLVPKALEPYVTEMAQGTFGGVFTTAGSRSNG    281 - 350
TWLSASDLTNIAIGMLATSSGGSQYSGSRVETPAVEEEEEEDNNDDDLSENDEDD                   351 - 405
//

Text Mined References (12)

PMID Year Title