Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q5H9E4 B2RTT9
Symbols MCART6

Gene

Gene RIF (1)

PMID Text
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.

AA Sequence

MGEQNHSPGKELQHRTRAEAPGKKSWHSQAYALGAVSNFMSTFLTFPIYKVVFRQQIHAMAVSEAVRQLW      1 - 70
HEGPQYFYRGIYPPLLSKTLQGTLLFGTYDSLLCFLSPVGPHTLGHRWAAGLMSGVVEAVALSPFERVQN     71 - 140
VLQDGRKQARFPSTFSILKEFNSYGLWGRLSLGYYRGFWPVLARNSLGSALYFSFKDPIQDGLAEQGLPH    141 - 210
WVPALVSGSVNGTITCLVLYPLIVLVANMQSHIGWQNMPSLWASAQDVWNTRGRKLLLIYRGGSLVILRS    211 - 280
SVTWGLTTAIHDFLQRKSHSRKELKTD                                               281 - 307
//

Text Mined References (4)

PMID Year Title
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.