Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 4.1e-05
pituitary cancer 1972 3.3e-04
non primary Sjogren syndrome sicca 891 2.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Gene RIF (1)

AA Sequence

MGEQNHSPGKELQHRTRAEAPGKKSWHSQAYALGAVSNFMSTFLTFPIYKVVFRQQIHAMAVSEAVRQLW      1 - 70
HEGPQYFYRGIYPPLLSKTLQGTLLFGTYDSLLCFLSPVGPHTLGHRWAAGLMSGVVEAVALSPFERVQN     71 - 140
VLQDGRKQARFPSTFSILKEFNSYGLWGRLSLGYYRGFWPVLARNSLGSALYFSFKDPIQDGLAEQGLPH    141 - 210
WVPALVSGSVNGTITCLVLYPLIVLVANMQSHIGWQNMPSLWASAQDVWNTRGRKLLLIYRGGSLVILRS    211 - 280
SVTWGLTTAIHDFLQRKSHSRKELKTD                                               281 - 307
//

Text Mined References (4)

PMID Year Title