Property Summary

NCBI Gene PubMed Count 5
PubMed Score 8.97
PubTator Score 6.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2716 6.0e-05
Breast cancer 3578 1.7e-04
diabetes mellitus 1728 1.5e-03

Gene RIF (2)

AA Sequence

MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNF      1 - 70
PHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST                                71 - 113
//

Text Mined References (7)

PMID Year Title