Property Summary

NCBI Gene PubMed Count 5
PubMed Score 9.25
PubTator Score 6.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (2)

PMID Text
26327325 CXorf61 is a target for T cell based immunotherapy of triple-negative breast cancer.
26026129 The frequency of KK-LC-1 expression was higher than that of the other CTAs. KK-LC-1 might be a useful target for immunotherapy and in diagnosis of gastric cancer.

AA Sequence

MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNF      1 - 70
PHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST                                71 - 113
//

Text Mined References (7)

PMID Year Title
26327325 2015 CXorf61 is a target for T cell based immunotherapy of triple-negative breast cancer.
26026129 2015 Frequent High Expression of Kita-Kyushu Lung Cancer Antigen-1 (KK-LC-1) in Gastric Cancer.
21630459 2011 Proteomic characterization of the human sperm nucleus.
16651449 2006 Identification of a new cancer/germline gene, KK-LC-1, encoding an antigen recognized by autologous CTL induced on human lung adenocarcinoma.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.