Property Summary

NCBI Gene PubMed Count 1
PubMed Score 3.62
PubTator Score 1.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.100 3.1e-03

Synonym

Accession Q5H913 B2RTT6 B4DX50
Symbols ARL13
dJ341D10.2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MFRLLSSCCSCLRTTEETRRNVTIPIIGLNNSGKTVLVEAFQKLLPSKTDHCMKSELTTLLLDEYELSIY      1 - 70
DLNGDLKGREAWPNYYAQAHGLVFVLDSSDIRRMQEVKIILTHLLSDKRVAGKPILILANKQDKKKALMP     71 - 140
CDIIDYLLLKKLVKENKCPCRVEPCSAIRNLERRNHQPIVEGLRWLLAVIDTCQLPPTSSISISKNNTGS    141 - 210
GERCSSHSFSTRTGMSKEKRQHLEQCSIEAKPLKSILQKEGTRLWSKKNMSVTFALDEPMKEGECSRRMR    211 - 280
AQNTTKLCYN                                                                281 - 290
//

Text Mined References (4)

PMID Year Title