Property Summary

NCBI Gene PubMed Count 1
Grant Count 2
R01 Count 2
Funding $427,485
PubMed Score 3.66
PubTator Score 1.24

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.100 0.003

AA Sequence

MFRLLSSCCSCLRTTEETRRNVTIPIIGLNNSGKTVLVEAFQKLLPSKTDHCMKSELTTLLLDEYELSIY      1 - 70
DLNGDLKGREAWPNYYAQAHGLVFVLDSSDIRRMQEVKIILTHLLSDKRVAGKPILILANKQDKKKALMP     71 - 140
CDIIDYLLLKKLVKENKCPCRVEPCSAIRNLERRNHQPIVEGLRWLLAVIDTCQLPPTSSISISKNNTGS    141 - 210
GERCSSHSFSTRTGMSKEKRQHLEQCSIEAKPLKSILQKEGTRLWSKKNMSVTFALDEPMKEGECSRRMR    211 - 280
AQNTTKLCYN                                                                281 - 290
//

Text Mined References (4)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.