Property Summary

NCBI Gene PubMed Count 10
PubMed Score 17.24
PubTator Score 9.07

Knowledge Summary

Patent

No data available

Gene RIF (5)

AA Sequence

MKHLRPQFPLILAIYCFCMLQIPSSGFPQPLADPSDGLDIVQLEQLAYCLSQWAPLSRQPKDNQDIYKRF      1 - 70
LFHYSRTQEATHPVKTGFPPVHPLMHLAAKLANRRMKRILQRGSGTAAVDFTKKDHTATWGRPFFLFRPR     71 - 140
NGRNIEDEAQIQW                                                             141 - 153
//

Text Mined References (10)

PMID Year Title