Property Summary

NCBI Gene PubMed Count 9
PubMed Score 17.02
PubTator Score 9.07

Knowledge Summary

Patent

No data available

Gene RIF (5)

PMID Text
25741729 Neuromedin s neurons define a subpopulation of pacemakers that control suprachiasmatic nucleus network synchrony.
20468064 Observational study of gene-disease association. (HuGE Navigator)
19519756 In man, NMS elicits vasoconstriction in isolated saphenous vein with comparable potency with NMU, but significantly reduces maximum contractile response.
18987052 both NMU receptor and peptide are expressed in human cardiovascular tissues and have shown that NMU-25 and NMS act as potent vasoconstrictors in human vascular beds
17870195 NMS is implicated in the regulation of circadian rhythm and feeding behavior

AA Sequence

MKHLRPQFPLILAIYCFCMLQIPSSGFPQPLADPSDGLDIVQLEQLAYCLSQWAPLSRQPKDNQDIYKRF      1 - 70
LFHYSRTQEATHPVKTGFPPVHPLMHLAAKLANRRMKRILQRGSGTAAVDFTKKDHTATWGRPFFLFRPR     71 - 140
NGRNIEDEAQIQW                                                             141 - 153
//

Text Mined References (9)

PMID Year Title
25741729 2015 Neuromedin s-producing neurons act as essential pacemakers in the suprachiasmatic nucleus to couple clock neurons and dictate circadian rhythms.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
19519756 2009 Emerging pharmacology and physiology of neuromedin U and the structurally related peptide neuromedin S.
18987052 2009 Expression and vasoconstrictor function of anorexigenic peptides neuromedin U-25 and S in the human cardiovascular system.
17870195 2008 Identification and functional analysis of a novel ligand for G protein-coupled receptor, Neuromedin S.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
15635449 2005 Identification of neuromedin S and its possible role in the mammalian circadian oscillator system.
10899166 2000 Identification and characterization of two neuromedin U receptors differentially expressed in peripheral tissues and the central nervous system.