Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.65
PubTator Score 4.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5GLZ8 Q5GC98 Q5GC99 Q5GCA0 Q8IXP9 Q9HCH9
Symbols

Gene

PANTHER Protein Class (2)

Gene RIF (5)

PMID Text
25684480 High HERC4 expression is associated with lung cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19460752 Knockdown of HECT and RLD domain containing E3 ubiquitin protein ligase 4 (HERC4) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
16385451 Observational study of gene-disease association. (HuGE Navigator)
15676274 HERC4 ancestor emerged in nematodes and that the family expanded throughout evolution. The mRNA expression pattern of the HERC4 was found to be diverse in selected tissues and cells

AA Sequence

MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEK      1 - 70
SRKKPEQVVALDAQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLGLVGSEECIRVPRNIKSLSDIQIV     71 - 140
QVACGYYHSLALSKASEVFCWGQNKYGQLGLGTDCKKQTSPQLLKSLLGIPFMQVAAGGAHSFVLTLSGA    141 - 210
IFGWGRNKFGQLGLNDENDRYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTS    211 - 280
HEINPRKVFELMGSIVTEIACGRQHTSAFVPSSGRIYSFGLGGNGQLGTGSTSNRKSPFTVKGNWYPYNG    281 - 350
QCLPDIDSEEYFCVKRIFSGGDQSFSHYSSPQNCGPPDDFRCPNPTKQIWTVNEALIQKWLSYPSGRFPV    351 - 420
EIANEIDGTFSSSGCLNGSFLAVSNDDHYRTGTRFSGVDMNAARLLFHKLIQPDHPQISQQVAASLEKNL    421 - 490
IPKLTSSLPDVEALRFYLTLPECPLMSDSNNFTTIAIPFGTALVNLEKAPLKVLENWWSVLEPPLFLKIV    491 - 560
ELFKEVVVHLLKLYKIGIPPSERRIFNSFLHTALKVLEILHRVNEKMGQIIQYDKFYIHEVQELIDIRND    561 - 630
YINWVQQQAYGMDVNHGLTELADIPVTICTYPFVFDAQAKTTLLQTDAVLQMQMAIDQAHRQNVSSLFLP    631 - 700
VIESVNPCLILVVRRENIVGDAMEVLRKTKNIDYKKPLKVIFVGEDAVDAGGVRKEFFLLIMRELLDPKY    701 - 770
GMFRYYEDSRLIWFSDKTFEDSDLFHLIGVICGLAIYNCTIVDLHFPLALYKKLLKKKPSLDDLKELMPD    771 - 840
VGRSMQQLLDYPEDDIEETFCLNFTITVENFGATEVKELVLNGADTAVNKQNRQEFVDAYVDYIFNKSVA    841 - 910
SLFDAFHAGFHKVCGGKVLLLFQPNELQAMVIGNTNYDWKELEKNTEYKGEYWAEHPTIKIFWEVFHELP    911 - 980
LEKKKQFLLFLTGSDRIPILGMKSLKLVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQAIDH    981 - 1050
NEGFSLI                                                                  1051 - 1057
//

Text Mined References (11)

PMID Year Title
25684480 2015 Expression of HERC4 in lung cancer and its correlation with clinicopathological parameters.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17967448 2007 Disruption of the ubiquitin ligase HERC4 causes defects in spermatozoon maturation and impaired fertility.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15676274 2005 The human HERC family of ubiquitin ligases: novel members, genomic organization, expression profiling, and evolutionary aspects.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...