Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.90
PubTator Score 4.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.300 9.8e-04
atypical teratoid / rhabdoid tumor -1.400 4.8e-05
glioblastoma -1.400 4.0e-04
hepatocellular carcinoma 1.100 2.0e-05
intraductal papillary-mucinous adenoma (... 2.500 8.5e-05
intraductal papillary-mucinous carcinoma... 2.100 1.9e-04
juvenile dermatomyositis 1.139 1.5e-10
malignant mesothelioma -2.000 3.6e-06
medulloblastoma -1.100 1.6e-03
medulloblastoma, large-cell -2.100 2.2e-05
non primary Sjogren syndrome sicca -1.300 1.7e-02
osteosarcoma -1.315 9.1e-05
ovarian cancer -1.200 2.3e-04
psoriasis -2.100 1.4e-04
subependymal giant cell astrocytoma 1.174 4.4e-02

 GWAS Trait (1)

Gene RIF (6)

AA Sequence

MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEK      1 - 70
SRKKPEQVVALDAQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLGLVGSEECIRVPRNIKSLSDIQIV     71 - 140
QVACGYYHSLALSKASEVFCWGQNKYGQLGLGTDCKKQTSPQLLKSLLGIPFMQVAAGGAHSFVLTLSGA    141 - 210
IFGWGRNKFGQLGLNDENDRYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTS    211 - 280
HEINPRKVFELMGSIVTEIACGRQHTSAFVPSSGRIYSFGLGGNGQLGTGSTSNRKSPFTVKGNWYPYNG    281 - 350
QCLPDIDSEEYFCVKRIFSGGDQSFSHYSSPQNCGPPDDFRCPNPTKQIWTVNEALIQKWLSYPSGRFPV    351 - 420
EIANEIDGTFSSSGCLNGSFLAVSNDDHYRTGTRFSGVDMNAARLLFHKLIQPDHPQISQQVAASLEKNL    421 - 490
IPKLTSSLPDVEALRFYLTLPECPLMSDSNNFTTIAIPFGTALVNLEKAPLKVLENWWSVLEPPLFLKIV    491 - 560
ELFKEVVVHLLKLYKIGIPPSERRIFNSFLHTALKVLEILHRVNEKMGQIIQYDKFYIHEVQELIDIRND    561 - 630
YINWVQQQAYGMDVNHGLTELADIPVTICTYPFVFDAQAKTTLLQTDAVLQMQMAIDQAHRQNVSSLFLP    631 - 700
VIESVNPCLILVVRRENIVGDAMEVLRKTKNIDYKKPLKVIFVGEDAVDAGGVRKEFFLLIMRELLDPKY    701 - 770
GMFRYYEDSRLIWFSDKTFEDSDLFHLIGVICGLAIYNCTIVDLHFPLALYKKLLKKKPSLDDLKELMPD    771 - 840
VGRSMQQLLDYPEDDIEETFCLNFTITVENFGATEVKELVLNGADTAVNKQNRQEFVDAYVDYIFNKSVA    841 - 910
SLFDAFHAGFHKVCGGKVLLLFQPNELQAMVIGNTNYDWKELEKNTEYKGEYWAEHPTIKIFWEVFHELP    911 - 980
LEKKKQFLLFLTGSDRIPILGMKSLKLVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQAIDH    981 - 1050
NEGFSLI                                                                  1051 - 1057
//

Text Mined References (12)

PMID Year Title