Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.23
PubTator Score 3.61

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MGKPRQNPSTLVSTLCEAEPKGKLWVNGYAGTQGTRDATLQTRLIPLSFHLQRGKGLAAPLSALSAPRLP      1 - 70
ERPADGRVAVDAQPAARSMDSDSGEQSEGEPVTAAGPDVFSSKSLALQAQKKILSKIASKTVANMLIDDT     71 - 140
SSEIFDELYKVTKEHTHNKKEAHKIMKDLIKVAIKIGILYRNNQFSQEELVIVEKFRKKLNQTAMTIVSF    141 - 210
YEVEYTFDRNVLSNLLHECKDLVHELVQRHLTPRTHGRINHVFNHFADVEFLSTLYSLDGDCRPNLKRIC    211 - 280
EGINKLLDEKVL                                                              281 - 292
//

Text Mined References (7)

PMID Year Title