Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.15
PubTator Score 3.61

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
25479791 TIPE3 protein is highly expressed in most human carcinoma cell lines. These results suggest that TIPE3 may play important roles in carcinogenesis and cell secretion.
25242044 human cancers have markedly upregulated TIPE3 expression. Knocking out TIPE3 diminishes tumorigenesis, whereas enforced TIPE3 expression enhances it in vivo

AA Sequence

MGKPRQNPSTLVSTLCEAEPKGKLWVNGYAGTQGTRDATLQTRLIPLSFHLQRGKGLAAPLSALSAPRLP      1 - 70
ERPADGRVAVDAQPAARSMDSDSGEQSEGEPVTAAGPDVFSSKSLALQAQKKILSKIASKTVANMLIDDT     71 - 140
SSEIFDELYKVTKEHTHNKKEAHKIMKDLIKVAIKIGILYRNNQFSQEELVIVEKFRKKLNQTAMTIVSF    141 - 210
YEVEYTFDRNVLSNLLHECKDLVHELVQRHLTPRTHGRINHVFNHFADVEFLSTLYSLDGDCRPNLKRIC    211 - 280
EGINKLLDEKVL                                                              281 - 292
//

Text Mined References (7)

PMID Year Title
25479791 2015 Identical expression profiling of human and murine TIPE3 protein reveals links to its functions.
25242044 2014 TIPE3 is the transfer protein of lipid second messengers that promote cancer.
21924498 2011 The TIPE (TNFAIP8) family in inflammation, immunity, and cancer.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.