Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.03
PubTator Score 4.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -3.300 6.9e-06
astrocytic glioma -2.200 1.7e-03
Astrocytoma, Pilocytic -2.200 3.5e-06
atypical teratoid / rhabdoid tumor -4.400 3.6e-09
ependymoma -2.800 3.4e-08
glioblastoma -3.000 6.5e-08
group 4 medulloblastoma -1.500 9.2e-03
intraductal papillary-mucinous adenoma (... -1.200 1.9e-04
intraductal papillary-mucinous carcinoma... -1.200 2.6e-04
intraductal papillary-mucinous neoplasm ... -1.200 2.6e-03
medulloblastoma, large-cell -3.800 8.7e-05
oligodendroglioma -1.900 5.9e-03
ovarian cancer 1.500 6.5e-03
primitive neuroectodermal tumor -2.300 1.6e-02
progressive supranuclear palsy 1.100 2.0e-02
psoriasis -1.100 4.9e-07

Synonym

Accession Q5GH76 Q96PZ8
Symbols XRG4

Gene

  Ortholog (1)

Species Source Disease
Chimp EggNOG Inparanoid

Gene RIF (6)

AA Sequence

MAAKSDGRLKMKKSSDVAFTPLQNSDHSGSVQGLAPGLPSGSGAEDEEAAGGGCCPDGGGCSRCCCCCAG      1 - 70
SGGSAGSGGSGGVAGPGGGGAGSAALCLRLGREQRRYSLWDCLWILAAVAVYFADVGTDVWLAVDYYLRG     71 - 140
QRWWFGLTLFFVVLGSLSVQVFSFRWFVHDFSTEDSATAAAASSCPQPGADCKTVVGGGSAAGEGEARPS    141 - 210
TPQRQASNASKSNIAAANSGSNSSGATRASGKHRSASCSFCIWLLQSLIHILQLGQIWRYFHTIYLGIRS    211 - 280
RQSGENDRWRFYWKMVYEYADVSMLHLLATFLESAPQLVLQLCIIVQTHSLQALQGFTAAASLVSLAWAL    281 - 350
ASYQKALRDSRDDKKPISYMAVIIQFCWHFFTIAARVITFALFASVFQLYFGIFIVLHWCIMTFWIVHCE    351 - 420
TEFCITKWEEIVFDMVVGIIYIFSWFNVKEGRTRCRLFIYYFVILLENTALSALWYLYKAPQIADAFAIP    421 - 490
ALCVVFSSFLTGVVFMLMYYAFFHPNGPRFGQSPSCACEDPAAAFTLPPDVATSTLRSISNNRSVVSDRD    491 - 560
QKFAERDGCVPVFQVRPTAPSTPSSRPPRIEESVIKIDLFRNRYPAWERHVLDRSLRKAILAFECSPSPP    561 - 630
RLQYKDDALIQERLEYETTL                                                      631 - 650
//

Text Mined References (7)

PMID Year Title