Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.53
PubTator Score 4.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Substance-Related Disorders 114
Disease Target Count P-value
psoriasis 6685 1.86470947702452E-35
atypical teratoid / rhabdoid tumor 4369 3.56659175174714E-9
ependymoma 2514 3.35280590530705E-8
pilocytic astrocytoma 3086 4.05117600300016E-6
adult high grade glioma 2148 6.91769468101341E-6
glioblastoma 5572 3.72973967930985E-5
medulloblastoma, large-cell 6234 8.6613776570317E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.9066051506402E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.59127305236894E-4
medulloblastoma 1524 7.39658989340436E-4
astrocytic glioma 2241 0.00167681008057534
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0026275309252178
oligodendroglioma 2849 0.005910385759922
ovarian cancer 8492 0.00646176944143316
primitive neuroectodermal tumor 3031 0.0155189161831038
progressive supranuclear palsy 674 0.0195525238784098

Expression

Synonym

Accession Q5GH76 Q96PZ8
Symbols XRG4

Gene

  Ortholog (5)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (6)

PMID Text
24852370 Findings suggest that the SNPs in XKR4 and near FOXE1 are involved in the regulation of TSH levels.
20607790 Two SNPs located in genes coding for as yet uncharacterized proteins expressed in the cerebellum, XKR4 in 8q12.1, and FAM190A in 4q22.1 suggest association with association with attention deficit hyperactivity disorder. [XkR4]
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19573479 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18521090 Genome-wide association study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of XK, Kell blood group complex subunit-related family, member 4 (XKR4) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MAAKSDGRLKMKKSSDVAFTPLQNSDHSGSVQGLAPGLPSGSGAEDEEAAGGGCCPDGGGCSRCCCCCAG      1 - 70
SGGSAGSGGSGGVAGPGGGGAGSAALCLRLGREQRRYSLWDCLWILAAVAVYFADVGTDVWLAVDYYLRG     71 - 140
QRWWFGLTLFFVVLGSLSVQVFSFRWFVHDFSTEDSATAAAASSCPQPGADCKTVVGGGSAAGEGEARPS    141 - 210
TPQRQASNASKSNIAAANSGSNSSGATRASGKHRSASCSFCIWLLQSLIHILQLGQIWRYFHTIYLGIRS    211 - 280
RQSGENDRWRFYWKMVYEYADVSMLHLLATFLESAPQLVLQLCIIVQTHSLQALQGFTAAASLVSLAWAL    281 - 350
ASYQKALRDSRDDKKPISYMAVIIQFCWHFFTIAARVITFALFASVFQLYFGIFIVLHWCIMTFWIVHCE    351 - 420
TEFCITKWEEIVFDMVVGIIYIFSWFNVKEGRTRCRLFIYYFVILLENTALSALWYLYKAPQIADAFAIP    421 - 490
ALCVVFSSFLTGVVFMLMYYAFFHPNGPRFGQSPSCACEDPAAAFTLPPDVATSTLRSISNNRSVVSDRD    491 - 560
QKFAERDGCVPVFQVRPTAPSTPSSRPPRIEESVIKIDLFRNRYPAWERHVLDRSLRKAILAFECSPSPP    561 - 630
RLQYKDDALIQERLEYETTL                                                      631 - 650
//

Text Mined References (7)

PMID Year Title
24852370 2014 Genome-wide association study identifies a novel susceptibility gene for serum TSH levels in Chinese populations.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
20607790 2010 Analysis of GWAS top hits in ADHD suggests association to two polymorphisms located in genes expressed in the cerebellum.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19573479 2009 Applicability of a genetic signature for enhanced iloperidone efficacy in the treatment of schizophrenia.
18521090 2009 Association of the NPAS3 gene and five other loci with response to the antipsychotic iloperidone identified in a whole genome association study.
11572484 2001 Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins.