Property Summary

NCBI Gene PubMed Count 13
Grant Count 19
R01 Count 4
Funding $2,152,386
PubMed Score 10.97
PubTator Score 7.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 0.000

Gene RIF (7)

PMID Text
21385852 We have revealed a novel Ca((2)+)-binding site at the A2 domain of VWF and demonstrated a relationship between Ca((2)+) and force in the regulation of VWF and primary hemostasis
18492952 By kinetic analysis of recombinant ADAMTS13 constructs, we show that the first thrombospondin-1, Cys-rich, and spacer domains of ADAMTS13 interact with segments of VWF domain A2 between Gln(1624) and Arg(1668).
18434322 O-glucosylation and O-fucosylation occur together in close proximity on the first epidermal growth factor repeat of AMACO
16385451 Observational study of gene-disease association. (HuGE Navigator)
15699509 Single nucleotide polymorphisms in the AMACO gene are associated with dominant protection against Type 1A diabetes in an Arab family.
15580307 CCSP-2 is a novel candidate for development as a diagnostic serum marker of early stage colon cancer
14506275 AMACO is a new member of the von Willebrand factor A-like domain protein superfamily with a regulated expression in the kidney

AA Sequence

MPPFLLLEAVCVFLFSRVPPSLPLQEVHVSKETIGKISAASKMMWCSAAVDIMFLLDGSNSVGKGSFERS      1 - 70
KHFAITVCDGLDISPERVRVGAFQFSSTPHLEFPLDSFSTQQEVKARIKRMVFKGGRTETELALKYLLHR     71 - 140
GLPGGRNASVPQILIIVTDGKSQGDVALPSKQLKERGVTVFAVGVRFPRWEELHALASEPRGQHVLLAEQ    141 - 210
VEDATNGLFSTLSSSAICSSATPDCRVEAHPCEHRTLEMVREFAGNAPCWRGSRRTLAVLAAHCPFYSWK    211 - 280
RVFLTHPATCYRTTCPGPCDSQPCQNGGTCVPEGLDGYQCLCPLAFGGEANCALKLSLECRVDLLFLLDS    281 - 350
SAGTTLDGFLRAKVFVKRFVRAVLSEDSRARVGVATYSRELLVAVPVGEYQDVPDLVWSLDGIPFRGGPT    351 - 420
LTGSALRQAAERGFGSATRTGQDRPRRVVVLLTESHSEDEVAGPARHARARELLLLGVGSEAVRAELEEI    421 - 490
TGSPKHVMVYSDPQDLFNQIPELQGKLCSRQRPGCRTQALDLVFMLDTSASVGPENFAQMQSFVRSCALQ    491 - 560
FEVNPDVTQVGLVVYGSQVQTAFGLDTKPTRAAMLRAISQAPYLGGVGSAGTALLHIYDKVMTVQRGARP    561 - 630
GVPKAVVVLTGGRGAEDAAVPAQKLRNNGISVLVVGVGPVLSEGLRRLAGPRDSLIHVAAYADLRYHQDV    631 - 700
LIEWLCGEAKQPVNLCKPSPCMNEGSCVLQNGSYRCKCRDGWEGPHCENRFLRRP                   701 - 755
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22685543 2012 A rapid cloning method employing orthogonal end protection.
21385852 2011 A novel calcium-binding site of von Willebrand factor A2 domain regulates its cleavage by ADAMTS13.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18492952 2008 Extensive contacts between ADAMTS13 exosites and von Willebrand factor domain A2 contribute to substrate specificity.
18434322 2008 O-glucosylation and O-fucosylation occur together in close proximity on the first epidermal growth factor repeat of AMACO (VWA2 protein).
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15699509 2004 IDDM17: polymorphisms in the AMACO gene are associated with dominant protection against type 1A diabetes in a Bedouin Arab family.
More...