Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.33
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Orchitis 16 4.58 2.3
Azoospermia 89 3.513 1.8

Expression

AA Sequence

MKLNLVQIFFMLLMLLLGLGMGLGLGLHMATAVLEESDQPLNEFWSSDSQDKAEATEEGDGTQTTETLVL      1 - 70
SNKEVVQPGWPEDPILGEDEVGGNKMLRASALFQSNKDYLRLDQTDRECNDMMAHKMKEPSQSCIAQYAF     71 - 140
IHEDLNTVKAVCNSPVIACELKGGKCHKSSRPFDLTLCELSQPDQVTPNCNYLTSVIKKHIIITCNDMKR    141 - 210
QLPTGQ                                                                    211 - 216
//

Text Mined References (8)

PMID Year Title
24811271 2014 Genome-wide SNP associations with rubella-specific cytokine responses in measles-mumps-rubella vaccine recipients.
24337645 2014 Comparative genomic analysis of eutherian ribonuclease A genes.
15676279 2005 The ribonuclease A superfamily of mammals and birds: identifying new members and tracing evolutionary histories.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12920233 2003 Discovery in silico and characterization in vitro of novel genes exclusively expressed in the mouse epididymis.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.