Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.33
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Orchitis 28 4.612 2.3
Azoospermia 110 3.518 1.8

Expression

Protein-protein Interaction (1)

AA Sequence

MKLNLVQIFFMLLMLLLGLGMGLGLGLHMATAVLEESDQPLNEFWSSDSQDKAEATEEGDGTQTTETLVL      1 - 70
SNKEVVQPGWPEDPILGEDEVGGNKMLRASALFQSNKDYLRLDQTDRECNDMMAHKMKEPSQSCIAQYAF     71 - 140
IHEDLNTVKAVCNSPVIACELKGGKCHKSSRPFDLTLCELSQPDQVTPNCNYLTSVIKKHIIITCNDMKR    141 - 210
QLPTGQ                                                                    211 - 216
//

Text Mined References (8)

PMID Year Title