Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.14

Knowledge Summary

Patent

No data available

Synonym

Accession Q5GAN4
Symbols RAI1
HEL-S-85p

Gene

 GO Function (1)

 GO Component (1)

AA Sequence

MIIMVIIFLVLLFWENEVNDEAVMSTLEHLHVDYPQNDVPVPARYCNHMIIQRVIREPDHTCKKEHVFIH      1 - 70
ERPRKINGICISPKKVACQNLSAIFCFQSETKFKMTVCQLIEGTRYPACRYHYSPTEGFVLVTCDDLRPD     71 - 140
SFLGYVK                                                                   141 - 147
//

Text Mined References (4)

PMID Year Title
24337645 2014 Comparative genomic analysis of eutherian ribonuclease A genes.
15676279 2005 The ribonuclease A superfamily of mammals and birds: identifying new members and tracing evolutionary histories.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.