Property Summary

NCBI Gene PubMed Count 3
Grant Count 6
R01 Count 6
Funding $202,218.43
PubMed Score 13.52
PubTator Score 4.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Onchocerciasis 8 4.676 2.3

AA Sequence

MAPAVTRLLFLQLVLGPTLVMDIKMQIGSRNFYTLSIDYPRVNYPKGFRGYCNGLMSYMRGKMQNSDCPK      1 - 70
IHYVIHAPWKAIQKFCKYSDSFCENYNEYCTLTQDSLPITVCSLSHQQPPTSCYYNSTLTNQKLYLLCSR     71 - 140
KYEADPIGIAGLYSGI                                                          141 - 156
//

Text Mined References (4)

PMID Year Title
24337645 2014 Comparative genomic analysis of eutherian ribonuclease A genes.
15676279 2005 The ribonuclease A superfamily of mammals and birds: identifying new members and tracing evolutionary histories.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.