Property Summary

NCBI Gene PubMed Count 4
PubMed Score 13.77
PubTator Score 4.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Onchocerciasis 10 4.635 2.3

Expression

Gene RIF (1)

AA Sequence

MAPAVTRLLFLQLVLGPTLVMDIKMQIGSRNFYTLSIDYPRVNYPKGFRGYCNGLMSYMRGKMQNSDCPK      1 - 70
IHYVIHAPWKAIQKFCKYSDSFCENYNEYCTLTQDSLPITVCSLSHQQPPTSCYYNSTLTNQKLYLLCSR     71 - 140
KYEADPIGIAGLYSGI                                                          141 - 156
//

Text Mined References (5)

PMID Year Title