Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.18
PubTator Score 0.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease 1.830 2.2e-02
active ulcerative colitis 1.499 7.6e-03
adult high grade glioma 1.200 3.7e-03
Astrocytoma, Pilocytic 1.500 5.0e-06
cystic fibrosis -1.143 3.2e-04
glioblastoma 1.200 1.6e-02
lung cancer 1.800 2.2e-05
lung carcinoma -1.500 1.5e-27
malignant mesothelioma -3.700 1.5e-09

Gene RIF (2)

AA Sequence

MAPRGCAGHPPPPSPQACVCPGKMLAMGALAGFWILCLLTYGYLSWGQALEEEEEGALLAQAGEKLEPST      1 - 70
TSTSQPHLIFILADDQGFRDVGYHGSEIKTPTLDKLAAEGVKLENYYVQPICTPSRSQFITGKYQIHTGL     71 - 140
QHSIIRPTQPNCLPLDNATLPQKLKEVGYSTHMVGKWHLGFYRKECMPTRRGFDTFFGSLLGSGDYYTHY    141 - 210
KCDSPGMCGYDLYENDNAAWDYDNGIYSTQMYTQRVQQILASHNPTKPIFLYIAYQAVHSPLQAPGRYFE    211 - 280
HYRSIININRRRYAAMLSCLDEAINNVTLALKTYGFYNNSIIIYSSDNGGQPTAGGSNWPLRGSKGTYWE    281 - 350
GGIRAVGFVHSPLLKNKGTVCKELVHITDWYPTLISLAEGQIDEDIQLDGYDIWETISEGLRSPRVDILH    351 - 420
NIDPIYTKAKNGSWAAGYGIWNTAIQSAIRVQHWKLLTGNPGYSDWVPPQSFSNLGPNRWHNERITLSTG    421 - 490
KSVWLFNITADPYERVDLSNRYPGIVKKLLRRLSQFNKTAVPVRYPPKDPRSNPRLNGGVWGPWYKEETK    491 - 560
KKKPSKNQAEKKQKKSKKKKKKQQKAVSGSTCHSGVTCG                                   561 - 599
//

Text Mined References (9)

PMID Year Title