Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.18
PubTator Score 0.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -3.700 0.000
glioblastoma 1.800 0.018
cystic fibrosis -1.143 0.000
lung cancer 1.800 0.000
active Crohn's disease 1.830 0.022
active ulcerative colitis 1.499 0.008
pediatric high grade glioma 1.600 0.006
pilocytic astrocytoma 1.400 0.000
lung carcinoma -1.500 0.000

Synonym

Accession Q5FYB0 A2RUG0 B7ZM45 Q1HA39 Q5FWE4 Q6UWT9 ASJ
Symbols

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
20332099 Observational study of gene-disease association. (HuGE Navigator)
16500042 The identification, molecular cloning and initial characterization of three new members of this human gene family is reported.

AA Sequence

MAPRGCAGHPPPPSPQACVCPGKMLAMGALAGFWILCLLTYGYLSWGQALEEEEEGALLAQAGEKLEPST      1 - 70
TSTSQPHLIFILADDQGFRDVGYHGSEIKTPTLDKLAAEGVKLENYYVQPICTPSRSQFITGKYQIHTGL     71 - 140
QHSIIRPTQPNCLPLDNATLPQKLKEVGYSTHMVGKWHLGFYRKECMPTRRGFDTFFGSLLGSGDYYTHY    141 - 210
KCDSPGMCGYDLYENDNAAWDYDNGIYSTQMYTQRVQQILASHNPTKPIFLYIAYQAVHSPLQAPGRYFE    211 - 280
HYRSIININRRRYAAMLSCLDEAINNVTLALKTYGFYNNSIIIYSSDNGGQPTAGGSNWPLRGSKGTYWE    281 - 350
GGIRAVGFVHSPLLKNKGTVCKELVHITDWYPTLISLAEGQIDEDIQLDGYDIWETISEGLRSPRVDILH    351 - 420
NIDPIYTKAKNGSWAAGYGIWNTAIQSAIRVQHWKLLTGNPGYSDWVPPQSFSNLGPNRWHNERITLSTG    421 - 490
KSVWLFNITADPYERVDLSNRYPGIVKKLLRRLSQFNKTAVPVRYPPKDPRSNPRLNGGVWGPWYKEETK    491 - 560
KKKPSKNQAEKKQKKSKKKKKKQQKAVSGSTCHSGVTCG                                   561 - 599
//

Text Mined References (9)

PMID Year Title
24165912 2013 Genome-wide association study identifies 8 novel loci associated with blood pressure responses to interventions in Han Chinese.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
16500042 2006 Molecular cloning and initial characterization of three novel human sulfatases.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16174644 2005 Sulfatases and sulfatase modifying factors: an exclusive and promiscuous relationship.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.