Property Summary

NCBI Gene PubMed Count 13
Grant Count 13
R01 Count 11
Funding $2,121,935.33
PubMed Score 147.10
PubTator Score 91.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
astrocytic glioma -1.100 0.020
osteosarcoma 1.119 0.000

Gene RIF (6)

PMID Text
26884333 Here is described a substrate recognition domain within ZRANB3 that is needed for it to recognize forked DNA structures, hydrolyze ATP, catalyze fork remodeling, and act as a structure-specific endonuclease.
22759634 a role for ZRANB3 in the replication stress response and suggest new insights into how DNA repair is coordinated with DNA replication to maintain genome stability.
22705370 AH2 is recruited to stalled replication forks and that cells depleted of AH2 are hypersensitive to replication stresses.
22704558 ZRANB3 translocase, a SNF2 family member related to the SIOD disorder SMARCAL1 protein, is recruited by polyubiquitinated PCNA to promote fork restart following replication arrest.
21078962 structural and functional differences between AH2 and HARP suggest that different annealing helicases have distinct functions in the cell.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MPRVHNIKKSLTPHISCVTNESDNLLDFLPDRLRAKLLPFQKDGIIFALKRNGRCMVADEMGLGKTIQAI      1 - 70
GITYFYKEEWPLLIVVPSSLRYPWTEEIEKWIPELSPEEINVIQNKTDVRRMSTSKVTVLGYGLLTADAK     71 - 140
TLIDALNNQNFKVVIVDESHYMKSRNATRSRILLPIVQKARRAILLTGTPALGRPEELFMQIEALFPQKF    141 - 210
GRWTDYAKRYCNAHIRYFGKRPQWDCRGASNLNELHQLLSDIMIRRLKTEVLTQLPPKVRQRIPFDLPSA    211 - 280
AAKELNTSFEEWEKIMRTPNSGAMETVMGLITRMFKQTAIAKAGAVKDYIKMMLQNDSLKFLVFAHHLSM    281 - 350
LQACTEAVIENKTRYIRIDGSVSSSERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWD    351 - 420
PGHIKQAEDRAHRIGQCSSVNIHYLIANGTLDTLMWGMLNRKAQVTGSTLNGRKEKIQAEEGDKEKWDFL    421 - 490
QFAEAWTPNDSSEELRKEALFTHFEKEKQHDIRSFFVPQPKKRQLMTSCDESKRFREENTVVSSDPTKTA    491 - 560
ARDIIDYESDVEPETKRLKLAASEDHCSPSEETPSQSKQIRTPLVESVQEAKAQLTTPAFPVEGWQCSLC    561 - 630
TYINNSELPYCEMCETPQGSAVMQIDSLNHIQDKNEKDDSQKDTSKKVQTISDCEKQALAQSEPGQLADS    631 - 700
KEETPKIEKEDGLTSQPGNEQWKSSDTLPVYDTLMFCASRNTDRIHIYTKDGKQMSCNFIPLDIKLDLWE    701 - 770
DLPASFQLKQYRSLILRFVREWSSLTAMKQRIIRKSGQLFCSPILALEEITKQQTKQNCTKRYITKEDVA    771 - 840
VASMDKVKNVGGHVRLITKESRPRDPFTKKLLEDGACVPFLNPYTVQADLTVKPSTSKGYLQAVDNEGNP    841 - 910
LCLRCQQPTCQTKQACKANSWDSRFCSLKCQEEFWIRSNNSYLRAKVFETEHGVCQLCNVNAQELFLRLR    911 - 980
DAPKSQRKNLLYATWTSKLPLEQLNEMIRNPGEGHFWQVDHIKPVYGGGGQCSLDNLQTLCTVCHKERTA    981 - 1050
RQAKERSQVRRQSLASKHGSDITRFLVKK                                            1051 - 1079
//

Publication (17)

PMID Year Title
26884333 2016 Identification of a Substrate Recognition Domain in the Replication Stress Response Protein Zinc Finger Ran-binding Domain-containing Protein 3 (ZRANB3).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22759634 2012 ZRANB3 is a structure-specific ATP-dependent endonuclease involved in replication stress response.
22705370 2012 The HARP-like domain-containing protein AH2/ZRANB3 binds to PCNA and participates in cellular response to replication stress.
22704558 2012 Polyubiquitinated PCNA recruits the ZRANB3 translocase to maintain genomic integrity after replication stress.
21078962 2010 Annealing helicase 2 (AH2), a DNA-rewinding motor with an HNH motif.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
More...