Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.33
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.000 7.8e-06
astrocytic glioma -1.900 1.5e-02
Astrocytoma, Pilocytic -1.100 6.6e-04
atypical teratoid / rhabdoid tumor -2.100 2.0e-07
ependymoma -2.100 1.8e-02
glioblastoma -1.800 5.9e-08
group 3 medulloblastoma -2.600 1.4e-05
intraductal papillary-mucinous carcinoma... -1.300 1.2e-03
invasive ductal carcinoma 1.800 8.8e-05
medulloblastoma, large-cell -3.100 8.4e-05
oligodendroglioma -1.800 1.7e-02
osteosarcoma -2.871 2.5e-09
ovarian cancer 1.200 7.2e-08
primitive neuroectodermal tumor -2.300 5.3e-05

Gene RIF (1)

AA Sequence

MASSPWGCVCGLLLLLLPLLGTGPALGRGFPRPLENSEIPMIPGAHPKGSVGSEPQAFDVFPENPRADSH      1 - 70
RNSDVRHAPAEEMPEKPVASPLGPALYGPKAAQGAQRERLPVTDDLQMAQGPSSHGWTGPLDSQELLQQE     71 - 140
AVAPHPVGHPHLTFIPTTPRRQLRVATVPPSLQHEGQEGQWPPRDEGLKAKTKSRVPPTSPSDHQGPPHT    141 - 210
LVSHSGTVKRPVLEGQGGFEEHLQEAAQGPHFTQQDPAAPDVGSVPPVEVVYSQEPGAQPDLALARSLPP    211 - 280
AEELPVETPKRAGAEVSWEVSSPGPPPKQADLPDAKDSPGPQPTDPPASEAPDRPSKPERAAMNGADPIS    281 - 350
PQRVRGAVEAPGTPKSLIPGPSDPGPAVNRTESPMGALQPDEAEEWPGRPQSHPPAPPVQAPSTSRRGLI    351 - 420
RVTTQRALGQPPPPEPTASSMASAPASSPPANATAPPLRWGPLRRVLSFSWELHVYGVGVLFLLPALLAL    421 - 490
AALAAAPAGPRLALVAAVLVLVASALRSAYMLTDPYGSQARLGVRGGLVLYNLPFPLLLTALAALTLLGL    491 - 560
GAGLPPPLQNPLLLGAVALVHGVGLLATDLLSTWSVLNLLTQGLSCAWGAAVALGTLCLCRRRLLDGPRG    561 - 630
WDASPGPRLLAVAGALGLLASGLQLAAALWLYPGPGRVGRFSWAWWGVHFWLRLLELTWALALALAAVAA    631 - 700
ARPRPPTEHACWAKLMRLACPAPSGKSEVPERPNNCYAGPSNVGAGSLDISKSLIRNPAESGQLATPSSG    701 - 770
AWGSAASLGRGPQGGPGLSRNGVGPAPSLSELDLRPPSPINLSRSIDAALFREHLVRDSVFQRCGLRGLA    771 - 840
SPPPGGALRPRRGSHPKAELDDAGSSLLRGRCRSLSDVRVRGPVPQHVVEAPDGAAAAASGSSLDSFSRG    841 - 910
SLKISWNPWRHGLSSVDSLPLDELPSTVQLLPAPTPAPDSTAARQGDGQGEVQPRGKPGESRSASSDTIE    911 - 980
L//

Text Mined References (8)

PMID Year Title