Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.13
PubTator Score 6.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 3.0e-10
ovarian cancer 8520 1.1e-08
medulloblastoma, large-cell 6241 2.1e-03
lung cancer 4740 3.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Adrenoleukodystrophy 29 3.475 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.300 3.4e-03
medulloblastoma, large-cell 1.300 2.1e-03
ovarian cancer 1.100 1.1e-08
psoriasis -1.100 3.0e-10

 IMPC Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (2)

AA Sequence

MTGTPKTQEGAKDLEVDMNKTEVTPRLWTTCRDGEVLLRLSKHGPGHETPMTIPEFFRESVNRFGTYPAL      1 - 70
ASKNGKKWEILNFNQYYEACRKAAKSLIKLGLERFHGVGILGFNSAEWFITAVGAILAGGLCVGIYATNS     71 - 140
AEVCQYVITHAKVNILLVENDQQLQKILSIPQSSLEPLKAIIQYRLPMKKNNNLYSWDDFMELGRSIPDT    141 - 210
QLEQVIESQKANQCAVLIYTSGTTGIPKGVMLSHDNITWIAGAVTKDFKLTDKHETVVSYLPLSHIAAQM    211 - 280
MDIWVPIKIGALTYFAQADALKGTLVSTLKEVKPTVFIGVPQIWEKIHEMVKKNSAKSMGLKKKAFVWAR    281 - 350
NIGFKVNSKKMLGKYNTPVSYRMAKTLVFSKVKTSLGLDHCHSFISGTAPLNQETAEFFLSLDIPIGELY    351 - 420
GLSESSGPHTISNQNNYRLLSCGKILTGCKNMLFQQNKDGIGEICLWGRHIFMGYLESETETTEAIDDEG    421 - 490
WLHSGDLGQLDGLGFLYVTGHIKEILITAGGENVPPIPVETLVKKKIPIISNAMLVGDKLKFLSMLLTLK    491 - 560
CEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQDPLVYKAIQQGINAVNQEAMNNAQRIEKWVI    561 - 630
LEKDFSIYGGELGPMMKLKRHFVAQKYKKQIDHMYH                                      631 - 666
//

Text Mined References (10)

PMID Year Title