Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.07
PubTator Score 6.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 3.01777243852927E-10
ovarian cancer 8492 1.1389608445303E-8
medulloblastoma, large-cell 6234 0.00209671241685758
lung cancer 4473 0.00344109806875478
Disease Target Count Z-score Confidence
Adrenoleukodystrophy 31 3.436 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.300 0.002
lung cancer 1.300 0.003
ovarian cancer 1.100 0.000
psoriasis -1.100 0.000

Synonym

Accession Q5FVE4 B3KSF2 Q6UWJ3 Q7Z5A0 Q8WW03 Q96M36 Q9BYZ3 Q9H0C4
Symbols BGR
BRGL
PRTDNY3
PRTD-NY3

Gene

PANTHER Protein Class (1)

  Ortholog (9)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (2)

PMID Text
16371355 The limited tissue expression pattern and limited substrate specificity rule out a likely role for this enzyme in X-linked adrenoleukodystrophy pathology.
15685348 A new gene exhibiting 50-fold difference in expression level between adult and fetal human testes was cloned and named the BGR-like gene. It was exclusively expressed in testes and was a testes-specific isoform of the BGR gene.

AA Sequence

MTGTPKTQEGAKDLEVDMNKTEVTPRLWTTCRDGEVLLRLSKHGPGHETPMTIPEFFRESVNRFGTYPAL      1 - 70
ASKNGKKWEILNFNQYYEACRKAAKSLIKLGLERFHGVGILGFNSAEWFITAVGAILAGGLCVGIYATNS     71 - 140
AEVCQYVITHAKVNILLVENDQQLQKILSIPQSSLEPLKAIIQYRLPMKKNNNLYSWDDFMELGRSIPDT    141 - 210
QLEQVIESQKANQCAVLIYTSGTTGIPKGVMLSHDNITWIAGAVTKDFKLTDKHETVVSYLPLSHIAAQM    211 - 280
MDIWVPIKIGALTYFAQADALKGTLVSTLKEVKPTVFIGVPQIWEKIHEMVKKNSAKSMGLKKKAFVWAR    281 - 350
NIGFKVNSKKMLGKYNTPVSYRMAKTLVFSKVKTSLGLDHCHSFISGTAPLNQETAEFFLSLDIPIGELY    351 - 420
GLSESSGPHTISNQNNYRLLSCGKILTGCKNMLFQQNKDGIGEICLWGRHIFMGYLESETETTEAIDDEG    421 - 490
WLHSGDLGQLDGLGFLYVTGHIKEILITAGGENVPPIPVETLVKKKIPIISNAMLVGDKLKFLSMLLTLK    491 - 560
CEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQDPLVYKAIQQGINAVNQEAMNNAQRIEKWVI    561 - 630
LEKDFSIYGGELGPMMKLKRHFVAQKYKKQIDHMYH                                      631 - 666
//

Text Mined References (10)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16762313 2006 A novel mammalian bubblegum-related acyl-CoA synthetase restricted to testes and possibly involved in spermatogenesis.
16371355 2006 The second member of the human and murine bubblegum family is a testis- and brainstem-specific acyl-CoA synthetase.
15685348 2005 Identification and characterization of the BGR-like gene with a potential role in human testicular development/spermatogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.