Property Summary

NCBI Gene PubMed Count 9
Grant Count 18
R01 Count 15
Funding $2,298,823.29
PubMed Score 2.07
PubTator Score 6.08

Knowledge Summary


No data available


  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.300 0.002
lung cancer 1.300 0.003
ovarian cancer 1.100 0.000
psoriasis -1.100 0.000

Protein-protein Interaction (2)

Gene RIF (2)

16371355 The limited tissue expression pattern and limited substrate specificity rule out a likely role for this enzyme in X-linked adrenoleukodystrophy pathology.
15685348 A new gene exhibiting 50-fold difference in expression level between adult and fetal human testes was cloned and named the BGR-like gene. It was exclusively expressed in testes and was a testes-specific isoform of the BGR gene.

AA Sequence

LEKDFSIYGGELGPMMKLKRHFVAQKYKKQIDHMYH                                      631 - 666

Publication (10)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16762313 2006 A novel mammalian bubblegum-related acyl-CoA synthetase restricted to testes and possibly involved in spermatogenesis.
16371355 2006 The second member of the human and murine bubblegum family is a testis- and brainstem-specific acyl-CoA synthetase.
15685348 2005 Identification and characterization of the BGR-like gene with a potential role in human testicular development/spermatogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.