Property Summary

NCBI Gene PubMed Count 50
PubMed Score 279.81
PubTator Score 54.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.200 4.8e-05
atypical teratoid / rhabdoid tumor 1.100 1.8e-03
group 3 medulloblastoma 1.400 1.5e-05
inflammatory breast cancer 1.400 4.4e-04
intraductal papillary-mucinous neoplasm ... 1.200 3.5e-03
lung adenocarcinoma 1.200 4.1e-09
medulloblastoma, large-cell 1.600 7.5e-05
non-small cell lung carcinoma 1.400 4.7e-17
ovarian cancer 1.300 5.7e-10
psoriasis 1.700 2.5e-82

 GO Function (1)

Gene RIF (33)

AA Sequence

MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALEN      1 - 70
EKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQ     71 - 140
IPLEETELPGQGESFQIEDQIPTIPQDTLGVDFDSGEAKSTDNVLPRTVSVRSSLKKHCNSICQFDSLDD    141 - 210
FETSHLAGKSFEFERVGFLDPLVNMHIPENVQHNACQWSKDQVNLSPKLIQPGTFTKTKEDILESKSEQT    211 - 280
KSKQRDTQERKREEKRKANRRKSKRMSKYKENKSENKKTVPQKKMHKSVSSNDAYNFNLEEGVHLTPFRQ    281 - 350
KVSNDSNREENNESEVSLCESSGSGDDSDDLYLPTCKYIQNPTSNSDRPVTRPLAKRALKYTDEKETEGS    351 - 420
KPTKTPTTTPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLA    421 - 490
SKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICL    491 - 560
R//

Text Mined References (55)

PMID Year Title