Property Summary

NCBI Gene PubMed Count 42
Grant Count 28
R01 Count 21
Funding $2,569,496.24
PubMed Score 259.67
PubTator Score 54.22

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (32)

PMID Text
26365192 Cohesin complex is shown to be a target of the prophase pathway at centrosomes and protected by Sgo1-dependent PP2A recruitment.
26359403 dysfunction of the inner centromere-shugoshin network might be a key mechanism underlying chromosomal instability in human tumorigenesis.
26190260 Results show that Sgo1 is first recruited to kinetochores by H2A-pT120, and the kinetochore-bound Sgo1 is released by centromeric transcription.
25892238 Sgo1 co-recruits Aurora B and PP2A to centromeres of unattached chromosomes.
25736928 our findings strongly suggest that CIP2A promotes cell cycle progression, premature chromosome segregation, and aneuploidy, possibly through a novel interaction with Sgol1.
25638162 Data indicate essential role of shugoshin-like protein 1 (Sgo1) in the maintenance of a proper mitotic progression in hepatoma cells and suggest that Sgo1 is a promising oncotarget for hepatocellular carcinoma (HCC).
25282101 Mutations in SGOL1 cause a novel cohesinopathy affecting heart and gut rhythm.
24055156 Bub1-mediated H2A phosphorylation penetrates kinetochores and that this histone mark contributes to a tension-sensitive Sgo1-based molecular switch for chromosome segregation.
23953852 The most significant association with MaxDrinks was observed with SNP rs11128951 (p = 4.27 x 10(-8)) near SGOL1 gene at 3p24.3.
23850494 Frameshift mutations of SGOL1 and PDS5B and the loss of their expression may be a feature of gastric and colorectal cancers with high microsatellite instability.
More...

AA Sequence

MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALEN      1 - 70
EKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQ     71 - 140
IPLEETELPGQGESFQIEDQIPTIPQDTLGVDFDSGEAKSTDNVLPRTVSVRSSLKKHCNSICQFDSLDD    141 - 210
FETSHLAGKSFEFERVGFLDPLVNMHIPENVQHNACQWSKDQVNLSPKLIQPGTFTKTKEDILESKSEQT    211 - 280
KSKQRDTQERKREEKRKANRRKSKRMSKYKENKSENKKTVPQKKMHKSVSSNDAYNFNLEEGVHLTPFRQ    281 - 350
KVSNDSNREENNESEVSLCESSGSGDDSDDLYLPTCKYIQNPTSNSDRPVTRPLAKRALKYTDEKETEGS    351 - 420
KPTKTPTTTPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLA    421 - 490
SKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICL    491 - 560
R//

Text Mined References (47)

PMID Year Title
26365192 2015 An Alternatively Spliced Bifunctional Localization Signal Reprograms Human Shugoshin 1 to Protect Centrosomal Instead of Centromeric Cohesin.
26359403 2015 The inner centromere-shugoshin network prevents chromosomal instability.
26190260 2015 Mitotic Transcription Installs Sgo1 at Centromeres to Coordinate Chromosome Segregation.
25892238 2015 Shugoshin-1 balances Aurora B kinase activity via PP2A to promote chromosome bi-orientation.
25736928 2015 Cancerous inhibitor of protein phosphatase 2A promotes premature chromosome segregation and aneuploidy in prostate cancer cells through association with shugoshin.
25638162 2015 Sgo1 is a potential therapeutic target for hepatocellular carcinoma.
25282101 2014 Mutations in SGOL1 cause a novel cohesinopathy affecting heart and gut rhythm.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24055156 2013 Phospho-H2A and cohesin specify distinct tension-regulated Sgo1 pools at kinetochores and inner centromeres.
23953852 2013 Genome-wide association studies of maximum number of drinks.
More...