Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.26
PubTator Score 15.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Bone Marrow failure syndromes 4 0.0 0.0
Disease Target Count P-value
glioblastoma 5792 4.2e-04
adult high grade glioma 3801 2.1e-03
osteosarcoma 7950 4.6e-03
medulloblastoma, large-cell 6241 5.3e-03
oligodendroglioma 2850 1.7e-02
astrocytic glioma 2597 3.7e-02
ependymoma 4679 4.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Essential Hypertension 94 0.0 0.7

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 2.1e-03
astrocytic glioma -1.300 3.7e-02
ependymoma -1.100 4.5e-02
glioblastoma -1.500 4.2e-04
medulloblastoma, large-cell -1.100 5.3e-03
oligodendroglioma -1.300 1.7e-02
osteosarcoma -1.554 4.6e-03

 GO Component (2)

 GO Process (1)

Gene RIF (3)

AA Sequence

MKCHYEALGVRRDASEEELKKAYRKLALKWHPDKNLDNAAEAAEQFKLIQAAYDVLSDPQERAWYDNHRE      1 - 70
ALLKGGFDGEYQDDSLDLLRYFTVTCYSGYGDDEKGFYTVYRNVFEMIAKEELESVLEEEVDDFPTFGDS     71 - 140
QSDYDTVVHPFYAYWQSFCTQKNFAWKEEYDTRQASNRWEKRAMEKENKKIRDKARKEKNELVRQLVAFI    141 - 210
RKRDKRVQAHRKLVEEQNAEKARKAEEMRRQQKLKQAKLVEQYREQSWMTMANLEKELQEMEARYEKEFG    211 - 280
DGSDENEMEEHELKDEEDGKDSDEAEDAELYDDLYCPACDKSFKTEKAMKNHEKSKKHREMVALLKQQLE    281 - 350
EEEENFSRPQIDENPLDDNSEEEMEDAPKQKLSKKQKKKKQKPAQNYDDNFNVNGPGEGVKVDPEDTNLN    351 - 420
QDSAKELEDSPQENVSVTEIIKPCDDPKSEAKSVPKPKGKKTKDMKKPVRVPAEPQTMSVLISCTTCHSE    421 - 490
FPSRNKLFDHLKATGHARAPSSSSLNSATSSQSKKEKRKNR                                 491 - 531
//

Text Mined References (19)

PMID Year Title