Property Summary

NCBI Gene PubMed Count 33
PubMed Score 16.11
PubTator Score 13.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma 2.039 7.3e-05
atypical teratoid / rhabdoid tumor 1.400 1.4e-03
Breast cancer 2.400 3.3e-07
ductal carcinoma in situ 1.200 1.9e-02
Endometriosis 1.356 2.5e-02
glioblastoma 1.200 2.8e-04
group 3 medulloblastoma 3.200 4.0e-05
interstitial cystitis 1.500 9.7e-04
intraductal papillary-mucinous carcinoma... 1.500 6.9e-04
intraductal papillary-mucinous neoplasm ... 2.100 7.5e-04
lung adenocarcinoma 1.400 4.5e-06
medulloblastoma, large-cell 1.400 6.2e-03
non-small cell lung cancer 2.182 1.7e-18
ovarian cancer 1.600 2.3e-05
pediatric high grade glioma 1.200 2.1e-03
pituitary cancer 1.200 5.2e-04
primitive neuroectodermal tumor 1.200 1.4e-02
psoriasis 1.100 3.7e-32
ulcerative colitis 1.700 5.4e-06

Protein-protein Interaction (2)

Gene RIF (21)

AA Sequence

MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRTNACASKCRVI      1 - 70
NKEHVLAAAKVILKKSRG                                                         71 - 88
//

Text Mined References (37)

PMID Year Title