Property Summary

NCBI Gene PubMed Count 31
Grant Count 4
R01 Count 4
Funding $347,583.25
PubMed Score 15.62
PubTator Score 13.31

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5EE01 A6NIR0 A6NJC2 CENP-W
Symbols CUG2
CENP-W
C6orf173

Gene

 GO Function (1)

Gene RIF (19)

PMID Text
26881882 CENP-W interacts with hnRNPU and may contribute to kinetochore-microtubule attachment in mitotic cells.
26111449 CENP-W is a novel kinetochore component that may be involved in the EZH2-mediated silencing machinery.
25329824 We propose that CENP-W, by influencing proper kinetochore assembly, particularly microtubule docking sites, can confer spindle pole resistance to traction forces exerted by motor proteins during chromosome congression
24452380 CUG2-mediated antiviral activity can be reduced by ISG15 deficiency in A549 cells, which eventually enhances sensitivity of the cells to vesicular stomatitis virus infection.
23926101 CSN5 regulates the stability of the inner kinetochore components CENP-T and CENP-W, providing the first direct link between CSN5 and the mitotic apparatus, highlighting the role of CSN5 as a multifunctional cell cycle regulator.
23917355 our results suggest that CUG2 enhances metastasis and drug resistance through STAT1 activation, which eventually contributes to tumor progression
23306614 we propose that VSV treatment combined with the selective regulation of genes such as STAT1 and OASL2 will improve therapeutic outcomes for CUG2-overexpressing tumors.
22131368 Single nucleotide polymorphism in CENPW is associated with the length of reproductive lifespan.
22002061 B23 may function in the assembly of the kinetochore complex by interacting with CENP-W during interphase
21695110 The CENP-T/W complex assembles through a dynamic exchange mechanism in late S-phase and G2, is required for mitosis in each cell cycle and does not persist across cell generations.
More...

AA Sequence

MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRTNACASKCRVI      1 - 70
NKEHVLAAAKVILKKSRG                                                         71 - 88
//

Text Mined References (35)

PMID Year Title
26881882 2016 Centromere Protein (CENP)-W Interacts with Heterogeneous Nuclear Ribonucleoprotein (hnRNP) U and May Contribute to Kinetochore-Microtubule Attachment in Mitotic Cells.
26111449 2015 A new kinetochore component CENP-W interacts with the polycomb-group protein EZH2 to promote gene silencing.
25329824 2014 CENP-W plays a role in maintaining bipolar spindle structure.
25281659 2015 A novel common variant in DCST2 is associated with length in early life and height in adulthood.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24452380 2014 Suppression of autophagic genes sensitizes CUG2-overexpressing A549 human lung cancer cells to oncolytic vesicular stomatitis virus-induced apoptosis.
23926101 2013 CSN5/JAB1 interacts with the centromeric components CENP-T and CENP-W and regulates their proteasome-mediated degradation.
23917355 2013 Cancer upregulated gene 2, a novel oncogene, enhances migration and drug resistance of colon cancer cells via STAT1 activation.
More...