Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.70
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Premature ovarian failure 65 4.089 2.0

Expression

AA Sequence

MEFVTALADLRAEASCPICLDYLKDPVTISCGHNFCLSCIIMSWKDLHDSFPCPFCHFCCPERKFISNPQ      1 - 70
LGSLTEIAKQLQIRSKKRKRQEEKHVCKKHNQVLTFFCQKDLELLCPRCSLSTDHQHHCVWPIKKAASYH     71 - 140
RKKLEEYNAPWKERVELIEKVITMQTRKSLELKKKMESPSVTRLECSCTISAHFNLRLPGSSDSSASGS     141 - 209
//

Text Mined References (5)

PMID Year Title