Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.70
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Premature ovarian failure 64 4.099 2.0

Expression

Synonym

Accession Q5EBN2
Symbols RNF35

Gene

 GO Function (1)

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

MEFVTALADLRAEASCPICLDYLKDPVTISCGHNFCLSCIIMSWKDLHDSFPCPFCHFCCPERKFISNPQ      1 - 70
LGSLTEIAKQLQIRSKKRKRQEEKHVCKKHNQVLTFFCQKDLELLCPRCSLSTDHQHHCVWPIKKAASYH     71 - 140
RKKLEEYNAPWKERVELIEKVITMQTRKSLELKKKMESPSVTRLECSCTISAHFNLRLPGSSDSSASGS     141 - 209
//

Text Mined References (5)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
15994318 2005 Negative transcriptional modulation and silencing of the bi-exonic Rnf35 gene in the preimplantation embryo. Binding of the CCAAT-displacement protein/Cux to the untranslated exon 1 sequence.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.