Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MLENYQNLVWLGLSISKSVISLLEKRKLPWIMAKEEIRGPLPGYFKVSEMTISQEPKAKTRTLFGKDVPG      1 - 70
AEIKELSAKRAINEVLSQFDTVIKCTRNVCKECGNLYCHNMQLTLHKRNHTQKKCNQCLDCGKYFTRQST     71 - 140
LIQHQRIHTGERPYKCNECIKTFNQRAHLT                                            141 - 170
//

Text Mined References (6)

PMID Year Title