Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 1.86521403972115E-13
ovarian cancer 8492 1.69244143000918E-6
posterior fossa group B ependymoma 1530 3.28797647827981E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 2.35747390033904E-4
osteosarcoma 7933 3.59903384967416E-4
atypical teratoid/rhabdoid tumor 1095 8.09020432503274E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.80890407263897E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00459274000589185
group 3 medulloblastoma 2254 0.0122244922196291
spina bifida 1064 0.0126004849436055

AA Sequence

LIQHQRIHTGERPYKCNECIKTFNQRAHLT                                            141 - 170

Text Mined References (6)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.