Property Summary

NCBI Gene PubMed Count 15
Grant Count 11
R01 Count 5
Funding $710,782.15
PubMed Score 65.11
PubTator Score 4.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma 1.400 0.000
ovarian cancer 1.200 0.000

Gene RIF (2)

PMID Text
27044745 PDZD11 forms a complex with nectin-1 and nectin-3, and its PDZ domain interacts directly with the PDZ-binding motif of nectin-1.
21183659 PDZD11 is an interacting partner with sodium-dependent multivitamin transporter in intestinal epithelial cells and that this interaction affects SMVT function and cell biology.

AA Sequence

MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQL      1 - 70
GIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH     71 - 140
//

Text Mined References (19)

PMID Year Title
27044745 2016 PLEKHA7 Recruits PDZD11 to Adherens Junctions to Stabilize Nectins.
25416956 2014 A proteome-scale map of the human interactome network.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
21269460 2011 Initial characterization of the human central proteome.
21183659 2011 Association of PDZ-containing protein PDZD11 with the human sodium-dependent multivitamin transporter.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16051599 2005 A single PDZ domain protein interacts with the Menkes copper ATPase, ATP7A. A new protein implicated in copper homeostasis.
15772651 2005 The DNA sequence of the human X chromosome.
More...