Property Summary

NCBI Gene PubMed Count 7
Grant Count 5
Funding $1,418,164
PubMed Score 222.65
PubTator Score 5.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Expression

  Differential Expression (1)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 1.161 0.024

Synonym

Accession Q5EBL4 Q66K36 Q8N1M0
Symbols RLP1
GOSPEL

Gene

PANTHER Protein Class (1)

AA Sequence

MEEERGSALAAESALEKNVAELTVMDVYDIASLVGHEFERVIDQHGCEAIARLMPKVVRVLEILEVLVSR      1 - 70
HHVAPELDELRLELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLSHK     71 - 140
DVNFSEEEFQKHEGMSERERQVMKKLKEVVDKQRDEIRAKDRELGLKNEDVEALQQQQTRLMKINHDLRH    141 - 210
RVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRAELGKLRERLQGEHSQNGEEEPETEPVGEESISDAE    211 - 280
KVAMDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEMEEENRIPQPPPIAHPRTSPQPE    281 - 350
SGIKRLFSFFSRDKKRLANTQRNVHIQESFGQWANTHRDDGYTEQGQEALQHL                     351 - 403
//

Text Mined References (13)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23264467 2013 The Rilp-like proteins Rilpl1 and Rilpl2 regulate ciliary membrane content.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19607794 2009 GOSPEL: a neuroprotective protein that binds to GAPDH upon S-nitrosylation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...