Property Summary

NCBI Gene PubMed Count 8
PubMed Score 232.69
PubTator Score 5.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
mucosa-associated lymphoid tissue lymphoma 484 2.4e-02
Disease Target Count Z-score Confidence
Alzheimer's disease 3 1 4.689 2.3

Expression

  Differential Expression (1)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 1.161 2.4e-02

Gene RIF (1)

AA Sequence

MEEERGSALAAESALEKNVAELTVMDVYDIASLVGHEFERVIDQHGCEAIARLMPKVVRVLEILEVLVSR      1 - 70
HHVAPELDELRLELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLSHK     71 - 140
DVNFSEEEFQKHEGMSERERQVMKKLKEVVDKQRDEIRAKDRELGLKNEDVEALQQQQTRLMKINHDLRH    141 - 210
RVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRAELGKLRERLQGEHSQNGEEEPETEPVGEESISDAE    211 - 280
KVAMDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEMEEENRIPQPPPIAHPRTSPQPE    281 - 350
SGIKRLFSFFSRDKKRLANTQRNVHIQESFGQWANTHRDDGYTEQGQEALQHL                     351 - 403
//

Text Mined References (14)

PMID Year Title