Property Summary

NCBI Gene PubMed Count 48
PubMed Score 128.62
PubTator Score 151.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Schizophrenia, Childhood 16
Weight Gain 87
Disease Target Count P-value
non-small cell lung cancer 2798 1.18566121348715E-12
juvenile dermatomyositis 1189 1.66441391712204E-11
malignant mesothelioma 3163 2.30821694315414E-10
Duchenne muscular dystrophy 602 1.92155485754618E-9
atypical teratoid / rhabdoid tumor 4369 1.26829427701112E-8
pilocytic astrocytoma 3086 4.42806670053256E-7
cystic fibrosis 1670 4.20485443779632E-6
ovarian cancer 8492 1.92663349474959E-5
sonic hedgehog group medulloblastoma 1482 1.20771459550985E-4
adult high grade glioma 2148 6.86814983144017E-4
tuberculosis 1563 0.00115229578881374
limb girdle muscular dystrophy 2B 74 0.002494471751743
Breast cancer 3099 0.0027695479260751
primitive neuroectodermal tumor 3031 0.00280830052740698
ductal carcinoma in situ 1745 0.00287792263403183
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00304944206295948
active ulcerative colitis 477 0.00332053697417365
pancreatic cancer 2300 0.00346829055816388
pancreatic carcinoma 567 0.00346829055816389
lung adenocarcinoma 2714 0.0048584493997259
glioblastoma 5572 0.00499526669024229
Becker muscular dystrophy 187 0.00612491888146104
breast carcinoma 1614 0.00707815511933488
invasive ductal carcinoma 2950 0.00949678103213646
esophageal adenocarcinoma 737 0.0176010007179145
Pick disease 1893 0.018868289496769
oligodendroglioma 2849 0.0253695965130983
gastric carcinoma 832 0.0401631396318865
nasopharyngeal carcinoma 1056 0.0426233972803612

Expression

Synonym

Accession Q5EB52 B2R6S1 O14973 O15007 Q6AI49 Q92571
Symbols PEG1

Gene

PANTHER Protein Class (3)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 GO Function (1)

Pathway (1)

Gene RIF (27)

PMID Text
23775149 altered DNA methylation at imprinted domains including IGF2/H19 and PEG1/MEST may mediate the association between human papillomavirus infection and invasive cervical cancer
23415968 Paternal methylation aberrations at imprinting control regions of DLK1-GTL2, MEST (PEG1), and ZAC (PLAGL1) and global methylation levels are not associated with idiopathic recurrent spontaneous miscarriages.
23343754 DNA methylation level at the H19 and MEST differentially methylated regions (DMRs)is reduced in placentas from pregnancies conceived by IVF/ICSI when compared with placentas from spontaneous conception.
23229728 The expression levels of miR-335 significantly correlated with those of MEST, supporting the notion that the intronic miR-335 is co-expressed with its host gene
23209187 These results support the idea that intrauterine exposure to gestational diabetes mellitus has long-lasting effects on the epigenome of the offspring.
22531794 MEST showed tissue-specific imprinting, being paternally expressed in skeletal muscle, fat, pituitary gland, heart, kidney, lung, stomach and uterus, and maternally expressed in spleen and liver.
22456293 In cortices, the MEST promoter was hemimethylated, as expected for a differentially methylated imprinting control region, whereas the COPG2 and TSGA14 promoters were completely demethylated, typical for transcriptionally active non-imprinted genes.
22249249 Data indicate that ARMCX2, COL1A1, MDK, MEST and MLH1 genes acquired methylation in drug-resistant ovarian cancer-sustaining (side population) cells.
21575949 Regardless of conception method, the PEG1 methylation percentage in chorionic villus from spontaneous abortions is significantly higher than in villus from induced abortions and multifetal reduction.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKSSGKFFTYKGLRIFYQDSVGVVGSPE      1 - 70
IVVLLHGFPTSSYDWYKIWEGLTLRFHRVIALDFLGFGFSDKPRPHHYSIFEQASIVEALLRHLGLQNRR     71 - 140
INLLSHDYGDIVAQELLYRYKQNRSGRLTIKSLCLSNGGIFPETHRPLLLQKLLKDGGVLSPILTRLMNF    141 - 210
FVFSRGLTPVFGPYTRPSESELWDMWAGIRNNDGNLVIDSLLQYINQRKKFRRRWVGALASVTIPIHFIY    211 - 280
GPLDPVNPYPEFLELYRKTLPRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF                   281 - 335
//

Text Mined References (50)

PMID Year Title
23775149 2014 PEG1/MEST and IGF2 DNA methylation in CIN and in cervical cancer.
23415968 2013 Methylation status of imprinted genes DLK1-GTL2, MEST (PEG1), ZAC (PLAGL1), and LINE-1 elements in spermatozoa of normozoospermic men, unlike H19 imprinting control regions, is not associated with idiopathic recurrent spontaneous miscarriages.
23343754 2013 Placentas from pregnancies conceived by IVF/ICSI have a reduced DNA methylation level at the H19 and MEST differentially methylated regions.
23229728 2013 Epigenetic silencing of miR-335 and its host gene MEST in hepatocellular carcinoma.
23209187 2013 Metabolic programming of MEST DNA methylation by intrauterine exposure to gestational diabetes mellitus.
22531794 2012 Conservation of genomic imprinting at the NDN, MAGEL2 and MEST loci in pigs.
22456293 2012 Methylation and expression analyses of the 7q autism susceptibility locus genes MEST , COPG2, and TSGA14 in human and anthropoid primate cortices.
22249249 2012 Candidate DNA methylation drivers of acquired cisplatin resistance in ovarian cancer identified by methylome and expression profiling.
21575949 2011 Assisted reproductive technologies do not increase risk of abnormal methylation of PEG1/MEST in human early pregnancy loss.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
More...