Property Summary

NCBI Gene PubMed Count 52
PubMed Score 137.23
PubTator Score 151.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
active ulcerative colitis -1.154 3.3e-03
adult high grade glioma 2.000 6.9e-04
Astrocytoma, Pilocytic 1.800 3.7e-07
atypical teratoid / rhabdoid tumor 3.000 1.3e-08
autosomal dominant Emery-Dreifuss muscul... 2.107 3.0e-03
Becker muscular dystrophy 1.253 6.1e-03
Breast cancer -1.400 2.8e-03
breast carcinoma -1.600 7.1e-03
cystic fibrosis -2.054 4.2e-06
Duchenne muscular dystrophy 2.378 1.9e-09
ductal carcinoma in situ -1.800 2.9e-03
esophageal adenocarcinoma 1.800 1.8e-02
gastric carcinoma 2.000 4.0e-02
glioblastoma 1.900 5.8e-05
group 4 medulloblastoma 1.200 7.9e-03
invasive ductal carcinoma -1.571 4.0e-03
juvenile dermatomyositis 2.000 1.7e-11
limb girdle muscular dystrophy 2A 1.123 1.1e-03
lung adenocarcinoma 1.100 2.6e-04
malignant mesothelioma -9.700 2.3e-10
nasopharyngeal carcinoma 1.600 4.3e-02
non-small cell lung cancer 1.481 1.2e-12
oligodendroglioma 1.300 2.5e-02
ovarian cancer -1.900 6.0e-04
pancreatic cancer 1.200 3.5e-03
pancreatic carcinoma 1.200 3.5e-03
Pick disease -1.300 1.9e-02
primitive neuroectodermal tumor 1.900 2.8e-03
tuberculosis 1.200 1.2e-03

Gene RIF (30)

AA Sequence

MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKSSGKFFTYKGLRIFYQDSVGVVGSPE      1 - 70
IVVLLHGFPTSSYDWYKIWEGLTLRFHRVIALDFLGFGFSDKPRPHHYSIFEQASIVEALLRHLGLQNRR     71 - 140
INLLSHDYGDIVAQELLYRYKQNRSGRLTIKSLCLSNGGIFPETHRPLLLQKLLKDGGVLSPILTRLMNF    141 - 210
FVFSRGLTPVFGPYTRPSESELWDMWAGIRNNDGNLVIDSLLQYINQRKKFRRRWVGALASVTIPIHFIY    211 - 280
GPLDPVNPYPEFLELYRKTLPRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF                   281 - 335
//

Text Mined References (54)

PMID Year Title