Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.15
PubTator Score 4.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
adrenocortical carcinoma -2.394 2.1e-04
Astrocytoma, Pilocytic -1.100 5.2e-03
atypical teratoid/rhabdoid tumor -1.900 1.1e-02
Endometriosis -1.742 1.2e-02
group 3 medulloblastoma -2.200 5.5e-03
ovarian cancer -1.500 2.9e-07

Gene RIF (4)

AA Sequence

MTSQRSPLAPLLLLSLHGVAASLEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQP      1 - 70
EQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTV     71 - 140
LVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSS    141 - 210
GLYQCVASNAIGTSTCLLDLQVISPQPRNIGLIAGAIGTGAVIIIFCIALILGAFFYWRSKNKEEEEEEI    211 - 280
PNEIREDDLPPKCSSAKAFHTEISSSDNNTLTSSNAYNSRYWSNNPKVHRNTESVSHFSDLGQSFSFHSG    281 - 350
NANIPSIYANGTHLVPGQHKTLVVTANRGSSPQVMSRSNGSVSRKPRPPHTHSYTISHATLERIGAVPVM    351 - 420
VPAQSRAGSLV                                                               421 - 431
//

Text Mined References (16)

PMID Year Title