Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.20
PubTator Score 5.62

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

AA Sequence

MRATAIVLLLALTLATMFSIECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSK      1 - 70
VKKTDGTLKFVHFGKC                                                           71 - 86
//

Text Mined References (7)

PMID Year Title