Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.16
PubTator Score 5.62

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
24441102 SPINK9 has a role in stimulating metalloprotease/EGFR-dependent keratinocyte migration by purinergic receptor pathway activation
22505519 the inhibition and binding of different SPINK9 variants towards KLK5, KLK7, KLK8 and KLK14
21899598 mSPINK12 shows an inhibitory activity against murine keratinocyte-derived trypsin-like proteolytic activity, and thus, appears orthologous to human LEKTI2 and may play an role in the regulation of epithelial cell functions.
19194479 possible role for SPINK9 in the site-specific epidermal differentiation of palms and soles
19190773 A new KLK5-inhibiting peptide encoded by a member of the Spink family, designated as Spink9 located on chromosome 5p33.1, was identified.

AA Sequence

MRATAIVLLLALTLATMFSIECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSK      1 - 70
VKKTDGTLKFVHFGKC                                                           71 - 86
//

Text Mined References (7)

PMID Year Title
24441102 2014 SPINK9 stimulates metalloprotease/EGFR-dependent keratinocyte migration via purinergic receptor activation.
22505519 2012 Characterization of SPINK9, a KLK5-specific inhibitor expressed in palmo-plantar epidermis.
21899598 2011 Expression and regulation of murine SPINK12, a potential orthologue of human LEKTI2.
19194479 2009 SPINK9: a selective, skin-specific Kazal-type serine protease inhibitor.
19190773 2009 Identification of lympho-epithelial Kazal-type inhibitor 2 in human skin as a kallikrein-related peptidase 5-specific protease inhibitor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.