Property Summary

NCBI Gene PubMed Count 56
PubMed Score 77.83
PubTator Score 38.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease 1.170 4.4e-02
active ulcerative colitis 2.332 6.3e-03
adrenocortical carcinoma -1.844 1.7e-06
Atopic dermatitis 1.700 4.6e-04
cystic fibrosis 1.200 2.6e-03
inflammatory breast cancer -1.100 3.9e-02
intraductal papillary-mucinous neoplasm ... 1.100 3.9e-02
lung cancer -1.200 1.1e-03
malignant mesothelioma -1.600 1.1e-05
pancreatic cancer 1.100 3.1e-04
pituitary cancer -1.400 4.3e-03
psoriasis 2.500 5.4e-10
tuberculosis -1.300 3.0e-03

Gene RIF (42)

AA Sequence

MSGPCGEKPVLEASPTMSLWEFEDSHSRQGTPRPGQELAAEEASALELQMKVDFFRKLGYSSTEIHSVLQ      1 - 70
KLGVQADTNTVLGELVKHGTATERERQTSPDPCPQLPLVPRGGGTPKAPNLEPPLPEEEKEGSDLRPVVI     71 - 140
DGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQHILRELEKKKILVF    141 - 210
TPSRRVGGKRVVCYDDRFIVKLAYESDGIVVSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDP    211 - 280
LGRHGPSLDNFLRKKPLTLEHRKQPCPYGRKCTYGIKCRFFHPERPSCPQRSVADELRANALLSPPRAPS    281 - 350
KDKNGRRPSPSSQSSSLLTESEQCSLDGKKLGAQASPGSRQEGLTQTYAPSGRSLAPSGGSGSSFGPTDW    351 - 420
LPQTLDSLPYVSQDCLDSGIGSLESQMSELWGVRGGGPGEPGPPRAPYTGYSPYGSELPATAAFSAFGRA    421 - 490
MGAGHFSVPADYPPAPPAFPPREYWSEPYPLPPPTSVLQEPPVQSPGAGRSPWGRAGSLAKEQASVYTKL    491 - 560
CGVFPPHLVEAVMGRFPQLLDPQQLAAEILSYKSQHPSE                                   561 - 599
//

Text Mined References (64)

PMID Year Title