Property Summary

NCBI Gene PubMed Count 40
Grant Count 10
R01 Count 5
Funding $787,562.49
PubMed Score 69.51
PubTator Score 38.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.600 0.000
psoriasis 3.700 0.000
Atopic dermatitis 1.700 0.000
adrenocortical carcinoma -1.844 0.000
tuberculosis -1.300 0.003
intraductal papillary-mucinous neoplasm ... 1.100 0.039
lung cancer -2.000 0.000
active Crohn's disease 1.170 0.044
ulcerative colitis 2.700 0.000
pancreatic cancer 1.200 0.042
cystic fibrosis 1.400 0.000
non-inflammatory breast cancer -1.300 0.021
pituitary cancer -1.400 0.004

Gene RIF (27)

PMID Text
26617772 Suggest that MCPIP1 may play an important role in cholesterol induced damage in endothelial cells.
26450708 miR-139-mediated downregulation of MCPIP1 promotes IL-6 expression in osteoarthritis.
26399696 demonstrated induction of MCPIP1 in human fibroblasts embedded in the stress-released 3-D collagen matrix, which occurred through activation of mitogen-activated protein kinases, phosphoinositide 3-kinase, and NF-kappaB
26329288 Findings show increased MCP1P expression in a model of Ischemia/Reperfusion Injury (I/R) and suggest a vital role for MCPIP1 in cell migration and apoptosis, resulting in increased angiogenesis and apoptosis during the late stages of I/R.
26315540 In white blood cells from patients with SLE, MCPIP1 expression was elevated, and its expression correlated positively with the IFN score and negatively with the miR-146a transcript level.
26134560 MCPIP1 and MCPIP4 form a complex but they act independently in regulation of IL-6 mRNA degradation.
25955820 In this review we summarize current progress regarding the specific characteristics of sequences and structures in the 3' untranslated regions of mRNAs that are recognized by tristetraproline, Roquins, and Regnase-1.
25225661 MCPIP1 may suppress hepatitis C virus replication and hepatitis C virus-mediated proinflammatory responses with infection, which might contribute to the regulation of host defense against the infection and virus-induced inflammation.
25187114 Data show that regulator of G protein signaling 2 (RGS2) was stabilized by deubiquitinase monocyte chemotactic protein-induced protein 1 (MCPIP1).
24270572 MCPIP1-associated USP10 is essential for negative regulation of NF-kappaB activation.
More...

AA Sequence

MSGPCGEKPVLEASPTMSLWEFEDSHSRQGTPRPGQELAAEEASALELQMKVDFFRKLGYSSTEIHSVLQ      1 - 70
KLGVQADTNTVLGELVKHGTATERERQTSPDPCPQLPLVPRGGGTPKAPNLEPPLPEEEKEGSDLRPVVI     71 - 140
DGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQHILRELEKKKILVF    141 - 210
TPSRRVGGKRVVCYDDRFIVKLAYESDGIVVSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDP    211 - 280
LGRHGPSLDNFLRKKPLTLEHRKQPCPYGRKCTYGIKCRFFHPERPSCPQRSVADELRANALLSPPRAPS    281 - 350
KDKNGRRPSPSSQSSSLLTESEQCSLDGKKLGAQASPGSRQEGLTQTYAPSGRSLAPSGGSGSSFGPTDW    351 - 420
LPQTLDSLPYVSQDCLDSGIGSLESQMSELWGVRGGGPGEPGPPRAPYTGYSPYGSELPATAAFSAFGRA    421 - 490
MGAGHFSVPADYPPAPPAFPPREYWSEPYPLPPPTSVLQEPPVQSPGAGRSPWGRAGSLAKEQASVYTKL    491 - 560
CGVFPPHLVEAVMGRFPQLLDPQQLAAEILSYKSQHPSE                                   561 - 599
//

Text Mined References (48)

PMID Year Title
26617772 2015 MCPIP is induced by cholesterol and participated in cholesterol-caused DNA damage in HUVEC.
26450708 2015 miR-139 modulates MCPIP1/IL-6 expression and induces apoptosis in human OA chondrocytes.
26399696 2015 MCPIP1 Regulates Fibroblast Migration in 3-D Collagen Matrices Downstream of MAP Kinases and NF-?B.
26329288 2015 The Role of MCPIP1 in Ischemia/Reperfusion Injury-Induced HUVEC Migration and Apoptosis.
26320658 2015 MCPIP1 Endoribonuclease Activity Negatively Regulates Interleukin-17-Mediated Signaling and Inflammation.
26315540 2015 Type I Interferon Inhibition of MicroRNA-146a Maturation Through Up-Regulation of Monocyte Chemotactic Protein-Induced Protein 1 in Systemic Lupus Erythematosus.
26134560 2015 Monocyte Chemotactic Protein-induced Protein 1 and 4 Form a Complex but Act Independently in Regulation of Interleukin-6 mRNA Degradation.
25955820 2015 Emerging Roles of CCCH-Type Zinc Finger Proteins in Destabilizing mRNA Encoding Inflammatory Factors and Regulating Immune Responses.
25861989 2015 TRAF Family Member-associated NF-?B Activator (TANK) Inhibits Genotoxic Nuclear Factor ?B Activation by Facilitating Deubiquitinase USP10-dependent Deubiquitination of TRAF6 Ligase.
25416956 2014 A proteome-scale map of the human interactome network.
More...