Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.28
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group B ependymoma 1.600 0.000
cutaneous lupus erythematosus -1.300 0.004
psoriasis -2.200 0.000
osteosarcoma -2.967 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q5D0E6 Q7Z5S7 Q86WY1 Q8N105 Q8NA89 Q9NVU8
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MATRRLGVGETLGALNAALGPGGPVWIKETRTRHLRSRDFLAPHRALQARFDDGQVPEHLLHALACLQGP      1 - 70
GVAPVLRCAPTPAGLSLQLQRSAVFERVLSAVAAYATPASPASLGQRVLLHCPALRSSPCALRLSQLRTV     71 - 140
LVADHLARALRAHGVCVRLVPAVRDPHMLTFLQQLRVDWPAASERASSHTLRSHALEELTSANDGRTLSP    141 - 210
GILGRLCLKELVEEQGRTAGYDPNLDNCLVTEDLLSVLAELQEALWHWPEDSHPGLAGASDTGTGGCLVV    211 - 280
HVVSCEEEFQQQKLDLLWQKLVDKAPLRQKHLICGPVKVAGAPGTLMTAPEYYEFRHTQVCKASALKHGG    281 - 350
DLAQDPAWTEIFGVLSVATIKFEMLSTAPQSQLFLALADSSISTKGTKSGTFVMYNCARLATLFESYKCS    351 - 420
MEQGLYPTFPPVSSLDFSLLHDEGEWLLLFNSILPFPDLLSRTAVLDCTAPGLHIAVRTEMICKFLVQLS    421 - 490
MDFSSYYNRVHILGEPRPHLFGQMFVRLQLLRAVREVLHTGLAMLGLPPLSHI                     491 - 543
//

Publication (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19906709 2010 Integrative analysis of the human cis-antisense gene pairs, miRNAs and their transcription regulation patterns.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.