Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.28
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 2.42843975673617E-10
osteosarcoma 7933 2.10944809211655E-9
psoriasis 6685 1.88718874868417E-5
ovarian cancer 8492 1.59180410474632E-4
cutaneous lupus erythematosus 1056 0.00442026240088017

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group B ependymoma 1.600 0.000
cutaneous lupus erythematosus -1.300 0.004
psoriasis -2.200 0.000
osteosarcoma -2.967 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q5D0E6 Q7Z5S7 Q86WY1 Q8N105 Q8NA89 Q9NVU8
Symbols

Gene

  Ortholog (6)

Species Source
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

AA Sequence

MATRRLGVGETLGALNAALGPGGPVWIKETRTRHLRSRDFLAPHRALQARFDDGQVPEHLLHALACLQGP      1 - 70
GVAPVLRCAPTPAGLSLQLQRSAVFERVLSAVAAYATPASPASLGQRVLLHCPALRSSPCALRLSQLRTV     71 - 140
LVADHLARALRAHGVCVRLVPAVRDPHMLTFLQQLRVDWPAASERASSHTLRSHALEELTSANDGRTLSP    141 - 210
GILGRLCLKELVEEQGRTAGYDPNLDNCLVTEDLLSVLAELQEALWHWPEDSHPGLAGASDTGTGGCLVV    211 - 280
HVVSCEEEFQQQKLDLLWQKLVDKAPLRQKHLICGPVKVAGAPGTLMTAPEYYEFRHTQVCKASALKHGG    281 - 350
DLAQDPAWTEIFGVLSVATIKFEMLSTAPQSQLFLALADSSISTKGTKSGTFVMYNCARLATLFESYKCS    351 - 420
MEQGLYPTFPPVSSLDFSLLHDEGEWLLLFNSILPFPDLLSRTAVLDCTAPGLHIAVRTEMICKFLVQLS    421 - 490
MDFSSYYNRVHILGEPRPHLFGQMFVRLQLLRAVREVLHTGLAMLGLPPLSHI                     491 - 543
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19906709 2010 Integrative analysis of the human cis-antisense gene pairs, miRNAs and their transcription regulation patterns.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.