Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.28
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.1e-09
psoriasis 6694 1.9e-05
ovarian cancer 8520 1.6e-04
cutaneous lupus erythematosus 1057 2.0e-03
ependymoma 4679 4.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus -1.100 2.0e-03
ependymoma 1.200 4.6e-02
osteosarcoma -2.967 2.1e-09
ovarian cancer 1.200 1.6e-04
psoriasis -2.200 1.9e-05

Synonym

Accession Q5D0E6 Q7Z5S7 Q86WY1 Q8N105 Q8NA89 Q9NVU8
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

AA Sequence

MATRRLGVGETLGALNAALGPGGPVWIKETRTRHLRSRDFLAPHRALQARFDDGQVPEHLLHALACLQGP      1 - 70
GVAPVLRCAPTPAGLSLQLQRSAVFERVLSAVAAYATPASPASLGQRVLLHCPALRSSPCALRLSQLRTV     71 - 140
LVADHLARALRAHGVCVRLVPAVRDPHMLTFLQQLRVDWPAASERASSHTLRSHALEELTSANDGRTLSP    141 - 210
GILGRLCLKELVEEQGRTAGYDPNLDNCLVTEDLLSVLAELQEALWHWPEDSHPGLAGASDTGTGGCLVV    211 - 280
HVVSCEEEFQQQKLDLLWQKLVDKAPLRQKHLICGPVKVAGAPGTLMTAPEYYEFRHTQVCKASALKHGG    281 - 350
DLAQDPAWTEIFGVLSVATIKFEMLSTAPQSQLFLALADSSISTKGTKSGTFVMYNCARLATLFESYKCS    351 - 420
MEQGLYPTFPPVSSLDFSLLHDEGEWLLLFNSILPFPDLLSRTAVLDCTAPGLHIAVRTEMICKFLVQLS    421 - 490
MDFSSYYNRVHILGEPRPHLFGQMFVRLQLLRAVREVLHTGLAMLGLPPLSHI                     491 - 543
//

Text Mined References (8)

PMID Year Title